PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

FANhyb_icon00030997_a.1.g00001.1

Organism

Fragaria x ananassa

Taxonomic ID

3747

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria

Family

TCP

Protein Properties

Length: 96aa MW: 10882.1 Da PI: 10.7452

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
FANhyb_icon00030997_a.1.g00001.1	genome	kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	42.3	2.8e-13	66	96	2	32
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarf 32 g+kdrhsk+ T++g+RdRRvRls+++a++f FANhyb_icon00030997_a.1.g00001.1 66 SGGKDRHSKVWTSKGLRDRRVRLSVSTAIQF 96 689**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	8.0E-13	67	96	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	16.58	68	96	IPR017887	Transcription factor TCP subgroup

Sequence ? help Back to Top
Protein Sequence Length: 96 aa Download sequence Send to blast
HECDAMEVEE IQAQQPCKFP RIGNGGRGSS SVAKNPDEED NNREIKTTNR LNGWHHSRII 60 RVSRASGGKD RHSKVWTSKG LRDRRVRLSV STAIQF

Functional Description ? help Back to Top
Source	Description
UniProt	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). Participates in ovule develpment (PubMed:25378179). Promotes light-regulated transcription of CHS, CAB, HYH and HY5. Regulates positively photomorphogenesis (e.g. hypocotyl elongation inhibition and cotyledon opening in response to blue light) (PubMed:26596765). {ECO:0000269\|PubMed:12931144, ECO:0000269\|PubMed:17307931, ECO:0000269\|PubMed:25378179, ECO:0000269\|PubMed:26596765}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the miRNA miR-JAW (PubMed:12931144). Induced by blue light. Stabilized by light but labile in darkness due to proteasome-dependent proteolysis (at protein level) (PubMed:26596765). {ECO:0000269\|PubMed:12931144, ECO:0000269\|PubMed:26596765}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004293547.1	7e-54	PREDICTED: transcription factor TCP2
Refseq	XP_011460218.1	7e-54	PREDICTED: transcription factor TCP2
Swissprot	Q93V43	2e-19	TCP2_ARATH; Transcription factor TCP2
TrEMBL	A0A2P6Q5R3	5e-43	A0A2P6Q5R3_ROSCH; Putative transcription factor TCP family
STRING	XP_004293547.1	3e-53	(Fragaria vesca)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF4019	31	56

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18390.2	9e-22	TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2

Publications ? help Back to Top
Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development. Plant Physiol., 2018. 176(2): p. 1694-1708 [PMID:29133375]