![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | FANhyb_icon00034214_a.1.g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 79aa MW: 8872.06 Da PI: 4.8293 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 37.1 | 8.4e-12 | 37 | 79 | 2 | 44 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHH CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpky 44
F++k+y++++d+++++li w + +nsf+v+++ ef++++Lp y
FANhyb_icon00034214_a.1.g00001.1 37 FVMKTYQMVNDPTTDRLIAWGRANNSFIVVEPLEFSQRLLPAY 79
9********************999****************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 2.0E-12 | 34 | 79 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 5.85E-10 | 34 | 78 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 4.3E-8 | 37 | 79 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 79 aa Download sequence Send to blast |
MITNTSQNQR ASSSSEAKPQ QSLMMSMEDS GNVIAPFVMK TYQMVNDPTT DRLIAWGRAN 60 NSFIVVEPLE FSQRLLPAY |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004287427.1 | 3e-49 | PREDICTED: heat stress transcription factor C-1 | ||||
| Swissprot | Q9LV52 | 1e-20 | HSFC1_ARATH; Heat stress transcription factor C-1 | ||||
| TrEMBL | A0A1B0V8F0 | 7e-48 | A0A1B0V8F0_FRAVE; Heat shock factor C1a | ||||
| STRING | XP_004287427.1 | 1e-48 | (Fragaria vesca) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24520.1 | 5e-23 | heat shock transcription factor C1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




