PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

FANhyb_icon00035201_a.1.g00001.1

Organism

Fragaria x ananassa

Taxonomic ID

3747

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria

Family

HSF

Protein Properties

Length: 74aa MW: 7473.12 Da PI: 3.4015

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
FANhyb_icon00035201_a.1.g00001.1	genome	kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	26.7	1.5e-08	45	74	2	31
HHHHHHHHHCTGGGTTTSEESSSSSEEEES CS HSF_DNA-bind 2 Flkklyeiledeelkeliswsengnsfvvl 31 Fl+k+y++++d+++++++sws ++nsfvv+ FANhyb_icon00035201_a.1.g00001.1 45 FLSKTYDMVDDPATDSIVSWSPTNNSFVVW 74 9******************999**98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	2.3E-10	39	74	IPR011991	Winged helix-turn-helix DNA-binding domain
SuperFamily	SSF46785	5.98E-8	40	74	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	5.3E-6	45	74	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 74 aa Download sequence Send to blast
MLMAGTSTNP DESTAGGGAQ TSAAGGSDSA PAPTPLLNSN APPPFLSKTY DMVDDPATDS 60 IVSWSPTNNS FVVW

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:7948881}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004300222.1	3e-35	PREDICTED: heat shock factor protein HSF8
Swissprot	P41151	5e-18	HFA1A_ARATH; Heat stress transcription factor A-1a
TrEMBL	A0A1W6LWH0	1e-34	A0A1W6LWH0_FRAAN; Heat shock transcription factor protein 1
STRING	XP_004300222.1	1e-34	(Fragaria vesca)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1592	33	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G17750.1	1e-18	heat shock factor 1

Publications ? help Back to Top
Hsu SF,Jinn TL AtHSBP functions in seed development and the motif is required for subcellular localization and interaction with AtHSFs. Plant Signal Behav, 2010. 5(8): p. 1042-4 [PMID:20657173] Liu HC,Charng YY Common and distinct functions of Arabidopsis class A1 and A2 heat shock factors in diverse abiotic stress responses and development. Plant Physiol., 2013. 163(1): p. 276-90 [PMID:23832625] Li S, et al. HEAT-INDUCED TAS1 TARGET1 Mediates Thermotolerance via HEAT STRESS TRANSCRIPTION FACTOR A1a-Directed Pathways in Arabidopsis. Plant Cell, 2014. 26(4): p. 1764-1780 [PMID:24728648] Muench M,Hsin CH,Ferber E,Berger S,Mueller MJ Reactive electrophilic oxylipins trigger a heat stress-like response through HSFA1 transcription factors. J. Exp. Bot., 2016. 67(21): p. 6139-6148 [PMID:27811081]