PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

FANhyb_icon00043401_a.1.g00001.1

Organism

Fragaria x ananassa

Taxonomic ID

3747

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria

Family

WRKY

Protein Properties

Length: 105aa MW: 11432.7 Da PI: 8.7172

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
FANhyb_icon00043401_a.1.g00001.1	genome	kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	56.3	6.3e-18	1	37	23	59
EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 sYYrCt+++C vkk+vers edp++v++tYeg+Hnh+ FANhyb_icon00043401_a.1.g00001.1 1 SYYRCTTQKCGVKKRVERSFEDPSTVITTYEGQHNHP 37 8***********************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	3.6E-16	1	39	IPR003657	WRKY domain
SuperFamily	SSF118290	1.27E-14	1	39	IPR003657	WRKY domain
PROSITE profile	PS50811	18.82	1	39	IPR003657	WRKY domain
SMART	SM00774	3.1E-9	1	38	IPR003657	WRKY domain
Pfam	PF03106	1.1E-12	1	37	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 105 aa Download sequence Send to blast
SYYRCTTQKC GVKKRVERSF EDPSTVITTY EGQHNHPIPA TLRGSININA AHHHHAFFSP 60 PSMYASAAPT TSSSGPSFPQ EYLFQMAQQP QMMMRNDGGG AGAGA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-13	1	40	39	78	Probable WRKY transcription factor 4
2lex_A	2e-13	1	40	39	78	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024158903.1	4e-60	probable WRKY transcription factor 71
Swissprot	Q93WV4	3e-23	WRK71_ARATH; WRKY transcription factor 71
TrEMBL	A0A2P6Q5A4	9e-59	A0A2P6Q5A4_ROSCH; Putative transcription factor WRKY family
STRING	XP_004293668.1	6e-51	(Fragaria vesca)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G29860.1	2e-25	WRKY DNA-binding protein 71

Publications ? help Back to Top
Guo D, et al. The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis. Plant Cell, 2015. 27(11): p. 3112-27 [PMID:26578700] Yu Y, et al. WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana. Plant J., 2016. 85(1): p. 96-106 [PMID:26643131] Guo D,Qin G EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses. Plant Signal Behav, 2016. 11(3): p. e1150404 [PMID:26914912] Yu Y, et al. WRKY71 Acts Antagonistically Against Salt-Delayed Flowering in Arabidopsis thaliana. Plant Cell Physiol., 2018. 59(2): p. 414-422 [PMID:29272465]