PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00043401_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WRKY
Protein Properties Length: 105aa    MW: 11432.7 Da    PI: 8.7172
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00043401_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY56.36.3e-181372359
                                      EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                              WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                                      sYYrCt+++C vkk+vers edp++v++tYeg+Hnh+
  FANhyb_icon00043401_a.1.g00001.1  1 SYYRCTTQKCGVKKRVERSFEDPSTVITTYEGQHNHP 37
                                      8***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.6E-16139IPR003657WRKY domain
SuperFamilySSF1182901.27E-14139IPR003657WRKY domain
PROSITE profilePS5081118.82139IPR003657WRKY domain
SMARTSM007743.1E-9138IPR003657WRKY domain
PfamPF031061.1E-12137IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
SYYRCTTQKC GVKKRVERSF EDPSTVITTY EGQHNHPIPA TLRGSININA AHHHHAFFSP  60
PSMYASAAPT TSSSGPSFPQ EYLFQMAQQP QMMMRNDGGG AGAGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-131403978Probable WRKY transcription factor 4
2lex_A2e-131403978Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024158903.14e-60probable WRKY transcription factor 71
SwissprotQ93WV43e-23WRK71_ARATH; WRKY transcription factor 71
TrEMBLA0A2P6Q5A49e-59A0A2P6Q5A4_ROSCH; Putative transcription factor WRKY family
STRINGXP_004293668.16e-51(Fragaria vesca)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.12e-25WRKY DNA-binding protein 71
Publications ? help Back to Top
  1. Guo D, et al.
    The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis.
    Plant Cell, 2015. 27(11): p. 3112-27
    [PMID:26578700]
  2. Yu Y, et al.
    WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana.
    Plant J., 2016. 85(1): p. 96-106
    [PMID:26643131]
  3. Guo D,Qin G
    EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses.
    Plant Signal Behav, 2016. 11(3): p. e1150404
    [PMID:26914912]
  4. Yu Y, et al.
    WRKY71 Acts Antagonistically Against Salt-Delayed Flowering in Arabidopsis thaliana.
    Plant Cell Physiol., 2018. 59(2): p. 414-422
    [PMID:29272465]