PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00048378_a.1.g00001.1
Organism
Fragaria x ananassa
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 52aa    MW: 6043.17 Da    PI: 10.3207
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00048378_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM58.42.4e-18752248
                               NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                                      ppGfrF+Ptd elv++yLk+kv gk++++ +vi++vdiyk+ PwdLp
  FANhyb_icon00048378_a.1.g00001.1  7 PPGFRFSPTDVELVKYYLKRKVLGKRVRV-QVIADVDIYKYAPWDLP 52
                                      9***************************9.99**************8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-18352IPR003441NAC domain
PROSITE profilePS5100520.713652IPR003441NAC domain
PfamPF023651.4E-8742IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 52 aa     Download sequence    Send to blast
MGKAAFPPGF RFSPTDVELV KYYLKRKVLG KRVRVQVIAD VDIYKYAPWD LP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-156521561Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004290500.11e-30PREDICTED: NAC domain-containing protein 78-like
RefseqXP_011458484.11e-30PREDICTED: NAC domain-containing protein 78-like
RefseqXP_011458485.11e-30PREDICTED: NAC domain-containing protein 78-like
RefseqXP_011458486.11e-30PREDICTED: NAC domain-containing protein 78-like
SwissprotQ9FY828e-19NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A2P6PRT41e-24A0A2P6PRT4_ROSCH; Putative transcription factor NAM family
STRINGXP_004290500.15e-30(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.43e-21NAC domain containing protein 82
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]