PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00049029_a.1.g00001.1
Organism
Fragaria x ananassa
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HSF
Protein Properties Length: 49aa    MW: 5403 Da    PI: 3.4015
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00049029_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind271.2e-082049231
                                      HHHHHHHHHCTGGGTTTSEESSSSSEEEES CS
                      HSF_DNA-bind  2 Flkklyeiledeelkeliswsengnsfvvl 31
                                      Fl+k+y++++d++++ l+sw++ +nsfvv+
  FANhyb_icon00049029_a.1.g00001.1 20 FLSKTYDMVDDPSTDYLVSWTAANNSFVVW 49
                                      9********************999****98 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.7E-91249IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467851.63E-71549IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004471.4E-52049IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 49 aa     Download sequence    Send to blast
MDGIEDTAAM INTATSIPPF LSKTYDMVDD PSTDYLVSWT AANNSFVVW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004294201.13e-24PREDICTED: heat stress transcription factor A-1b-like
RefseqXP_011460871.13e-24PREDICTED: heat stress transcription factor A-1b-like
TrEMBLA0A1B0VC558e-23A0A1B0VC55_FRAVE; Heat shock factor A1b
STRINGXP_004294201.11e-23(Fragaria vesca)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02990.12e-16heat shock transcription factor A1E