PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

FANhyb_icon18533625_o.1.g00001.1

Organism

Fragaria x ananassa

Taxonomic ID

3747

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria

Family

SBP

Protein Properties

Length: 78aa MW: 8457.72 Da PI: 9.8757

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
FANhyb_icon18533625_o.1.g00001.1	genome	kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	72.7	6.6e-23	25	72	2	49
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 Cq+++C+adl +ak+y+rrhkvC++hskapvv++ gl+qrfCqqCsr FANhyb_icon18533625_o.1.g00001.1 25 CQAQSCNADLRDAKQYYRRHKVCDFHSKAPVVVIGGLRQRFCQQCSRC 72 **********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	6.3E-24	18	72	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	18.802	22	78	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.83E-22	23	73	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	2.3E-17	25	72	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
MVMNSASATS PSKKGSAAGG SMTSCQAQSC NADLRDAKQY YRRHKVCDFH SKAPVVVIGG 60 LRQRFCQQCS RCSLQTLI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj0_A	2e-17	20	71	1	52	squamosa promoter-binding protein-like 12
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269\|PubMed:12671094, ECO:0000269\|PubMed:16095614, ECO:0000269\|PubMed:17093870}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004293885.1	1e-42	PREDICTED: squamosa promoter-binding-like protein 3
Swissprot	Q38741	1e-20	SBP1_ANTMA; Squamosa promoter-binding protein 1
Swissprot	Q8GXL3	4e-20	SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBL	A0A2P6Q483	3e-34	A0A2P6Q483_ROSCH; Squamosa promoter-binding-like protein
STRING	XP_004293885.1	6e-42	(Fragaria vesca)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF535	34	153

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G02065.2	2e-22	squamosa promoter binding protein-like 8

Publications ? help Back to Top
Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Xing S, et al. SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility. Plants (Basel), 2013. 2(3): p. 416-28 [PMID:27137384] Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]