![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | FANhyb_rscf00000041.1.g00023.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 101aa MW: 11483.1 Da PI: 4.8099 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 80.7 | 2.2e-25 | 25 | 83 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Flkk ye+++dee++++iswse+++sfv++d ++f+ +LpkyFkhsnf+SF+RQLn+Y
FANhyb_rscf00000041.1.g00023.1 25 FLKKCYEMVDDEETDSIISWSESNDSFVIKDVTQFSVMMLPKYFKHSNFSSFMRQLNIY 83
9*********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 3.1E-26 | 16 | 83 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 2.99E-22 | 21 | 84 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 1.2E-16 | 21 | 95 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 5.2E-21 | 25 | 83 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 9.0E-15 | 25 | 48 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 9.0E-15 | 63 | 75 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 9.0E-15 | 76 | 88 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MVRKSKEKEK TGEGSSSADA SVAPFLKKCY EMVDDEETDS IISWSESNDS FVIKDVTQFS 60 VMMLPKYFKH SNFSSFMRQL NIYVSISFGF CIAFLEVVCG F |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 3e-18 | 14 | 83 | 17 | 87 | Heat shock factor protein 1 |
| 5d5v_B | 3e-18 | 14 | 83 | 17 | 87 | Heat shock factor protein 1 |
| 5d5v_D | 3e-18 | 14 | 83 | 17 | 87 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004297421.1 | 2e-50 | PREDICTED: heat stress transcription factor A-8 isoform X1 | ||||
| Swissprot | Q9S7U5 | 1e-26 | HSFA8_ARATH; Heat stress transcription factor A-8 | ||||
| TrEMBL | A0A2P6R3N3 | 3e-44 | A0A2P6R3N3_ROSCH; Putative transcription factor HSF-type-DNA-binding family | ||||
| STRING | XP_004297421.1 | 8e-50 | (Fragaria vesca) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G67970.1 | 2e-29 | heat shock transcription factor A8 | ||||




