![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | FANhyb_rscf00000109.1.g00019.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 157aa MW: 18118.9 Da PI: 9.9701 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 90.6 | 8e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n + rqvtfskRr gilKKAeELSvLCda++a+iifsstgkl+ey+s
FANhyb_rscf00000109.1.g00019.1 9 KKIDNATARQVTFSKRRRGILKKAEELSVLCDADIALIIFSSTGKLFEYAS 59
68***********************************************86 PP
| |||||||
| 2 | K-box | 35.9 | 3.2e-13 | 92 | 155 | 19 | 82 |
K-box 19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqk 82
++++L kei +++R++ Ge+L+ L+l+eLqqLe+ Le++l ++ +kK l+e+ ++l++
FANhyb_rscf00000109.1.g00019.1 92 SNYSRLSKEITAKSHQLRQMRGEELHGLNLEELQQLEKSLESGLGRVIEKKAIQLIEENKRLKQ 155
6799*****************************************************9999987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 8.4E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 30.501 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 5.44E-39 | 2 | 75 | No hit | No description |
| SuperFamily | SSF55455 | 1.57E-31 | 3 | 76 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.2E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 10.588 | 87 | 157 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 1.7E-10 | 92 | 156 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009266 | Biological Process | response to temperature stimulus | ||||
| GO:0009910 | Biological Process | negative regulation of flower development | ||||
| GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
| GO:0010582 | Biological Process | floral meristem determinacy | ||||
| GO:0030154 | Biological Process | cell differentiation | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0048438 | Biological Process | floral whorl development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 157 aa Download sequence Send to blast |
MAREKIQIKK IDNATARQVT FSKRRRGILK KAEELSVLCD ADIALIIFSS TGKLFEYASS 60 SMKEILERHH LHSKNLDKLE QPSLELQLVE NSNYSRLSKE ITAKSHQLRQ MRGEELHGLN 120 LEELQQLEKS LESGLGRVIE KKAIQLIEEN KRLKQQV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 7e-23 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_B | 7e-23 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_C | 7e-23 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_D | 7e-23 | 1 | 69 | 1 | 69 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00272 | DAP | Transfer from AT2G22540 | Download |
| |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011468571.1 | 1e-102 | PREDICTED: MADS-box protein JOINTLESS | ||||
| Refseq | XP_011468575.1 | 1e-102 | PREDICTED: MADS-box protein JOINTLESS | ||||
| Swissprot | Q9FUY6 | 1e-86 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
| TrEMBL | A0A2P6RPZ3 | 4e-95 | A0A2P6RPZ3_ROSCH; Putative transcription factor MADS-MIKC family | ||||
| STRING | XP_004288518.1 | 1e-100 | (Fragaria vesca) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF890 | 33 | 106 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G22540.1 | 4e-71 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




