PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

FANhyb_rscf00000204.1.g00010.1

Organism

Fragaria x ananassa

Taxonomic ID

3747

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria

Family

WRKY

Protein Properties

Length: 50aa MW: 5958.62 Da PI: 6.7887

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
FANhyb_rscf00000204.1.g00010.1	genome	kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	38.3	2.7e-12	2	31	30	59
TT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 30 agCpvkkkversaedpkvveitYegeHnhe 59 +C+vkk+ver aedp++v++tYeg+H h+ FANhyb_rscf00000204.1.g00010.1 2 DNCRVKKRVERLAEDPRMVITTYEGRHAHS 31 69***************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50811	11.497	1	33	IPR003657	WRKY domain
SMART	SM00774	2.2E-4	1	32	IPR003657	WRKY domain
SuperFamily	SSF118290	1.44E-8	2	32	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	3.1E-10	2	31	IPR003657	WRKY domain
Pfam	PF03106	7.4E-8	3	30	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 50 aa Download sequence Send to blast
MDNCRVKKRV ERLAEDPRMV ITTYEGRHAH SPSHDLEDSE SPSRLNNFFW

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004288129.1	7e-30	PREDICTED: probable WRKY transcription factor 13
Refseq	XP_011464710.1	7e-30	PREDICTED: probable WRKY transcription factor 13
Refseq	XP_011464713.1	7e-30	PREDICTED: probable WRKY transcription factor 13
Swissprot	Q9SVB7	1e-16	WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBL	A0A2P6RRK4	2e-26	A0A2P6RRK4_ROSCH; Putative transcription factor WRKY family
STRING	XP_004288129.1	3e-29	(Fragaria vesca)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF4079	33	61

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G39410.1	4e-19	WRKY DNA-binding protein 13