PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

FANhyb_rscf00006944.1.g00001.1

Organism

Fragaria x ananassa

Taxonomic ID

3747

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria

Family

MYB_related

Protein Properties

Length: 103aa MW: 12042.9 Da PI: 9.0381

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
FANhyb_rscf00006944.1.g00001.1	genome	kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.3	7.5e-18	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+ +Ed++l+d+++++G g+W++ + g++R++k+c++rw++yl FANhyb_rscf00006944.1.g00001.1 13 KGAWSIQEDQKLIDYIQKHGEGCWNSLPTAAGLRRCGKSCRLRWRNYL 60 79*********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	6.1E-24	4	62	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.187	8	64	IPR017930	Myb domain
SMART	SM00717	9.7E-12	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	1.5E-16	13	60	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.0E-22	14	88	IPR009057	Homeodomain-like
CDD	cd00167	1.70E-9	15	60	No hit	No description
PROSITE profile	PS50090	4.008	61	89	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	9.0E-8	63	89	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 103 aa Download sequence Send to blast
MRKPCCEKTE TTKGAWSIQE DQKLIDYIQK HGEGCWNSLP TAAGLRRCGK SCRLRWRNYL 60 RPDLKRGSFG EDEEDLIIRL HKLLGNRYES QINPLPFPKL IPE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-17	10	96	24	109	MYB TRANSFORMING PROTEIN
Search in ModeBase

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004299542.1	7e-57	PREDICTED: transcription factor MYB3-like
Swissprot	Q9S9K9	9e-43	MYB3_ARATH; Transcription factor MYB3
TrEMBL	A0A2I6UI39	2e-56	A0A2I6UI39_FRAAN; R2R3-MYB transcription factor MYB1-2
TrEMBL	E7BLK1	2e-56	E7BLK1_9ROSA; Transcription factor
TrEMBL	Q94EN3	2e-56	Q94EN3_FRAAN; R2R3-MYB transcription factor MYB1-1
STRING	XP_004299542.1	3e-56	(Fragaria vesca)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	4e-45	myb domain protein 3

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]