![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G000686_P08 | ||||||||
| Common Name | CA2P11, umc1568 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 146aa MW: 16149.4 Da PI: 10.8649 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 108.3 | 6e-34 | 38 | 94 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep+YVNaKQy++Il+RRq Rakle+e+kl ksrkpylheSRh hA++R+Rg+gGrF
GRMZM2G000686_P08 38 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKSRKPYLHESRHLHAMKRARGTGGRF 94
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 1.1E-38 | 36 | 97 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 39.221 | 37 | 97 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 2.7E-29 | 39 | 94 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 5.3E-25 | 40 | 62 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 42 | 62 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 5.3E-25 | 71 | 94 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010262 | Biological Process | somatic embryogenesis | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 146 aa Download sequence Send to blast |
MMPFVHFEDT LLGNAMHPQL VGMVPSSRVP LPIEPAAEEP IYVNAKQYHA ILRRRQLRAK 60 LEAENKLVKS RKPYLHESRH LHAMKRARGT GGRFLNTKQQ PESPGSGGSS DAQRVPATAS 120 GGLFTKHEHS LPPGGRHHYH ARGGGE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 3e-24 | 38 | 106 | 2 | 74 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.85146 | 0.0 | ear| embryo| endosperm| meristem| pollen| shoot| tassel | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G000686 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the whole plant, except roots. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:17322342}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the blue light (BL) and abscisic acid (ABA) signaling pathways. {ECO:0000250, ECO:0000269|PubMed:17322342}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G000686_P08 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT038953 | 0.0 | BT038953.1 Zea mays full-length cDNA clone ZM_BFb0345D16 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008664550.1 | 1e-90 | NF-YA1 isoform X4 | ||||
| Swissprot | Q9SYH4 | 8e-38 | NFYA5_ARATH; Nuclear transcription factor Y subunit A-5 | ||||
| TrEMBL | B4FPB5 | 1e-102 | B4FPB5_MAIZE; CCAAT-HAP2 transcription factor | ||||
| STRING | GRMZM2G000686_P04 | 3e-89 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G54160.1 | 7e-35 | nuclear factor Y, subunit A5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G000686_P08 |




