![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G001139_P03 | ||||||||
| Common Name | LOC100216936, LOC100286160, ZEAMMB73_488091 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 190aa MW: 21609.6 Da PI: 8.0709 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 74.8 | 6.8e-24 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krien ++rq tf kRr g++KKA ELSvLCd++ ++++fs++gkly y
GRMZM2G001139_P03 9 KRIENPTQRQSTFYKRRDGLFKKARELSVLCDVDLLLLLFSTSGKLYHYL 58
79*********************************************996 PP
| |||||||
| 2 | K-box | 27.5 | 1.3e-10 | 74 | 162 | 10 | 98 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98
+++++++ + el+k ++ e +++e+R + +d e+ ++ L+ Le+ Le +++k+Rs K++ + +i++l + + +ee L +kl
GRMZM2G001139_P03 74 ATTHTKERRAELEKAEQMCELMEKELRVMTVDDGEQYTVPSLELLEHSLEAAVRKVRSEKDRKIGGEINYLENIIRGRHEERYGLCNKL 162
567899999**************************************************************999999999998888776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 2.6E-32 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 28.581 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.54E-28 | 2 | 93 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-23 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.4E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-23 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-23 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 2.8E-12 | 75 | 162 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 9.627 | 78 | 168 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 190 aa Download sequence Send to blast |
MGRGRSEIKR IENPTQRQST FYKRRDGLFK KARELSVLCD VDLLLLLFST SGKLYHYLSP 60 TVPSVKDLVE RYEATTHTKE RRAELEKAEQ MCELMEKELR VMTVDDGEQY TVPSLELLEH 120 SLEAAVRKVR SEKDRKIGGE INYLENIIRG RHEERYGLCN KLAHSQASNN EGGGGSTPPS 180 SGLELKLGLN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 5e-14 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
| 6byy_B | 5e-14 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
| 6byy_C | 5e-14 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
| 6byy_D | 5e-14 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
| 6bz1_A | 5e-14 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
| 6bz1_B | 5e-14 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
| 6bz1_C | 5e-14 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
| 6bz1_D | 5e-14 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G001139 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G001139_P03 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU975895 | 0.0 | EU975895.1 Zea mays clone 504661 MADS-box transcription factor 32 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008654489.1 | 1e-137 | putative MADS-box transcription factor family protein isoform X1 | ||||
| Swissprot | Q8S151 | 1e-102 | MAD32_ORYSJ; MADS-box transcription factor 32 | ||||
| TrEMBL | B6UF80 | 1e-135 | B6UF80_MAIZE; MADS-box transcription factor 32 | ||||
| STRING | GRMZM2G001139_P01 | 1e-122 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G09960.2 | 3e-16 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G001139_P03 |
| Entrez Gene | 100216936 | 100286160 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




