![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G003489_P03 | ||||||||
| Common Name | Zm.41316 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 117aa MW: 12899.5 Da PI: 4.1824 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 77.1 | 3e-24 | 53 | 111 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+y++++d+++++++sw g+sfvv+d + fa +Lp+yFkhsnf+SFvRQLn+Y
GRMZM2G003489_P03 53 FLTKTYDVVDDPNTDTIVSWGFAGTSFVVWDANAFALVILPRYFKHSNFSSFVRQLNTY 111
9*********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 4.0E-25 | 47 | 111 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 2.8E-18 | 49 | 117 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 6.94E-22 | 49 | 112 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 4.2E-20 | 53 | 111 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.3E-14 | 53 | 76 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.3E-14 | 91 | 103 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.3E-14 | 104 | 116 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 117 aa Download sequence Send to blast |
MDPFHGIVKE EFDLDFDFTC ASAAAAAAAS WAVALPEMPR PMEGLGEVGP TPFLTKTYDV 60 VDDPNTDTIV SWGFAGTSFV VWDANAFALV ILPRYFKHSN FSSFVRQLNT YVRVQEG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 4e-18 | 44 | 117 | 17 | 98 | Heat shock factor protein 1 |
| 5d5v_B | 4e-18 | 44 | 117 | 17 | 98 | Heat shock factor protein 1 |
| 5d5v_D | 4e-18 | 44 | 117 | 17 | 98 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.41316 | 0.0 | endosperm | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G003489 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G003489_P03 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Not induced by heat stress. {ECO:0000269|PubMed:18064488}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT085816 | 0.0 | BT085816.2 Zea mays full-length cDNA clone ZM_BFc0067H20 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001335364.1 | 3e-76 | uncharacterized protein LOC109621226 | ||||
| Refseq | XP_020395790.1 | 3e-76 | uncharacterized protein LOC109621226 isoform X1 | ||||
| Swissprot | Q84MN7 | 8e-49 | HFA2A_ORYSJ; Heat stress transcription factor A-2a | ||||
| TrEMBL | A0A1D6L3W5 | 7e-75 | A0A1D6L3W5_MAIZE; Heat stress transcription factor A-6b | ||||
| TrEMBL | A0A317YJD5 | 7e-75 | A0A317YJD5_MAIZE; Heat stress transcription factor A-2a | ||||
| STRING | Si036148m | 3e-55 | (Setaria italica) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26150.1 | 2e-35 | heat shock transcription factor A2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G003489_P03 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




