![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G006477_P02 | ||||||||
| Common Name | LOC100382084 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 287aa MW: 31175.1 Da PI: 6.5025 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 100 | 1.6e-31 | 231 | 281 | 1 | 51 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
k+r+rWtpeLHe+Fv+av+qLGGsekAtPk +l+lmkv+gLt++hvkSHLQ
GRMZM2G006477_P02 231 KQRMRWTPELHECFVDAVNQLGGSEKATPKGVLKLMKVDGLTIYHVKSHLQ 281
79************************************************* PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 11.332 | 228 | 287 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 4.3E-16 | 229 | 284 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 7.0E-29 | 230 | 281 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.4E-23 | 231 | 282 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 9.8E-9 | 233 | 281 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 287 aa Download sequence Send to blast |
MRNFNLMQSQ KSRVLGAMSS SLPILPNPLK GSFSRPHNPQ HIPMLRQLPD DSMPLCIDTH 60 QSASLHPRAG VIGVPYSGYT ASPLDSVSNL DSQTMAAPFI SQSSNFEALQ SLSNNTPETH 120 TKAAWFTSSM DVSPLNTDNI AASDVNQIQS IRPAMTSDES ATQNDWWADI MNDDWKDILD 180 ATATDSHSKA MIQISNSATS LPAVNQSASS HSREICPVAS PPNSSNASVA KQRMRWTPEL 240 HECFVDAVNQ LGGSEKATPK GVLKLMKVDG LTIYHVKSHL QVCCLAF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4k_A | 2e-26 | 230 | 281 | 1 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 2e-26 | 230 | 281 | 1 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_A | 2e-26 | 231 | 281 | 1 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 2e-26 | 231 | 281 | 1 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 2e-26 | 231 | 281 | 1 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 2e-26 | 231 | 281 | 1 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 2e-26 | 230 | 281 | 1 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 2e-26 | 230 | 281 | 1 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 2e-26 | 230 | 281 | 1 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 2e-26 | 230 | 281 | 1 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 2e-26 | 230 | 281 | 1 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 2e-26 | 230 | 281 | 1 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.23516 | 0.0 | endosperm| meristem| root| shoot | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G006477 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G006477_P02 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT063102 | 0.0 | BT063102.1 Zea mays full-length cDNA clone ZM_BFc0026F11 mRNA, complete cds. | |||
| GenBank | KJ726832 | 0.0 | KJ726832.1 Zea mays clone pUT3372 G2-like transcription factor (GLK17) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001168318.1 | 0.0 | uncharacterized protein LOC100382084 | ||||
| Refseq | XP_008643769.1 | 0.0 | putative MYB DNA-binding domain superfamily protein isoform X1 | ||||
| Refseq | XP_008643772.1 | 0.0 | putative MYB DNA-binding domain superfamily protein isoform X1 | ||||
| Refseq | XP_020393478.1 | 0.0 | putative MYB DNA-binding domain superfamily protein isoform X1 | ||||
| Refseq | XP_020393489.1 | 0.0 | putative MYB DNA-binding domain superfamily protein isoform X1 | ||||
| Swissprot | B8ANX9 | 1e-102 | PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1 | ||||
| TrEMBL | C0P483 | 0.0 | C0P483_MAIZE; G2-like transcription factor | ||||
| STRING | GRMZM2G006477_P01 | 0.0 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G28610.1 | 2e-29 | phosphate starvation response 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G006477_P02 |




