![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G009892_P04 | ||||||||
| Common Name | LOC100284412, Zm.139631 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 165aa MW: 18511.2 Da PI: 10.0632 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 174.5 | 3e-54 | 11 | 136 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92
lppGfrFhPtdeel+++yL++k+++ ++ + +++e+d++k+ePwdLp+ ++ +ekewyfF+ +d+ky+tg r+nrat++gyWkatgkd++v
GRMZM2G009892_P04 11 LPPGFRFHPTDEELITHYLARKAADARFAA-LAVAEADLNKCEPWDLPSLARMGEKEWYFFCLKDRKYPTGLRTNRATEAGYWKATGKDRDV 101
79*************************999.67***************8778899************************************* PP
NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
++ +++lvg kktLvfy+grap+gek+ Wvmheyrl
GRMZM2G009892_P04 102 FR-GKALVGSKKTLVFYTGRAPRGEKSGWVMHEYRL 136
**.99*****************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.57E-59 | 7 | 145 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 52.635 | 11 | 158 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.4E-29 | 12 | 136 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 165 aa Download sequence Send to blast |
MEQEPHRPME LPPGFRFHPT DEELITHYLA RKAADARFAA LAVAEADLNK CEPWDLPSLA 60 RMGEKEWYFF CLKDRKYPTG LRTNRATEAG YWKATGKDRD VFRGKALVGS KKTLVFYTGR 120 APRGEKSGWV MHEYRLHAKL HGHGHGHGQG AAVVVVPKAA GTKVG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 1e-51 | 2 | 136 | 8 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-51 | 2 | 136 | 8 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-51 | 2 | 136 | 8 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-51 | 2 | 136 | 8 | 142 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
| 3swm_B | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
| 3swm_C | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
| 3swm_D | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
| 3swp_A | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
| 3swp_B | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
| 3swp_C | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
| 3swp_D | 1e-51 | 2 | 136 | 11 | 145 | NAC domain-containing protein 19 |
| 4dul_A | 1e-51 | 2 | 136 | 8 | 142 | NAC domain-containing protein 19 |
| 4dul_B | 1e-51 | 2 | 136 | 8 | 142 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.29227 | 0.0 | endosperm | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G009892 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G009892_P04 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT060770 | 0.0 | BT060770.2 Zea mays full-length cDNA clone ZM_BFb0046M18 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001150779.2 | 1e-117 | NAC domain protein NAC5 | ||||
| Refseq | XP_020403374.1 | 1e-117 | NAC domain protein NAC5 isoform X1 | ||||
| Swissprot | Q9FLJ2 | 7e-76 | NC100_ARATH; NAC domain-containing protein 100 | ||||
| TrEMBL | C0P5H4 | 1e-116 | C0P5H4_MAIZE; NAC domain-containing protein 79 | ||||
| TrEMBL | K0DFF7 | 1e-116 | K0DFF7_MAIZE; NAC32 NAC type transcription factor (Fragment) | ||||
| STRING | GRMZM2G009892_P03 | 1e-117 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G61430.1 | 2e-68 | NAC domain containing protein 100 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G009892_P04 |
| Entrez Gene | 100284412 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




