PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G010871_P05
Common NameLOC100280736
Organism
Zea mays
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HSF
Protein Properties Length: 110aa    MW: 12061.5 Da    PI: 4.3508
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G010871_P05genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind742.8e-2346104260
                        HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
       HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 
                        Fl+k+++++ed++++ ++sws+ gnsf+v+d++ fa+ +Lp+ Fkhsnf+SFvRQLn+Y
  GRMZM2G010871_P05  46 FLTKTFDLVEDPATDAVLSWSRAGNSFIVWDPHVFADGLLPRLFKHSNFSSFVRQLNTY 104
                        9*********************************************************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.102.2E-2539104IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.3E-1842109IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467851.32E-2142104IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000569.7E-154669IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004472.4E-2046105IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.7E-158496IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.7E-1597109IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MDKPVAPGII KEELLEQQPP TQDGVGGGGD APRPMEGLHE VGPPPFLTKT FDLVEDPATD  60
AVLSWSRAGN SFIVWDPHVF ADGLLPRLFK HSNFSSFVRQ LNTYMEQDTG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B2e-18441042787Heat shock factor protein 1
5d5v_B2e-18441042787Heat shock factor protein 1
5d5v_D2e-18441042787Heat shock factor protein 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.282351e-177endosperm| meristem| pericarp| pollen| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G010871
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves and immature seeds. {ECO:0000269|PubMed:16202242}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269|PubMed:16202242}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G010871_P05
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat stress. {ECO:0000269|PubMed:16202242}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0883470.0BT088347.1 Zea mays full-length cDNA clone ZM_BFc0150H22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147128.28e-71heat shock factor protein HSF30
RefseqNP_001353351.18e-71heat shock factor protein HSF30
RefseqXP_008673662.18e-71heat shock factor protein HSF30 isoform X1
RefseqXP_008673666.18e-71heat shock factor protein HSF30 isoform X1
RefseqXP_008673672.18e-71heat shock factor protein HSF30 isoform X1
RefseqXP_008673683.18e-71heat shock factor protein HSF30 isoform X1
SwissprotQ338B03e-52HFA2C_ORYSJ; Heat stress transcription factor A-2c
TrEMBLA0A060D2062e-69A0A060D206_MAIZE; HSF transcription factor (Fragment)
TrEMBLA0A317YB412e-69A0A317YB41_MAIZE; Heat stress transcription factor A-2c
STRINGGRMZM2G010871_P023e-70(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26150.12e-38heat shock transcription factor A2
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Singh A, et al.
    OsHsfA2c and OsHsfB4b are involved in the transcriptional regulation of cytoplasmic OsClpB (Hsp100) gene in rice (Oryza sativa L.).
    Cell Stress Chaperones, 2012. 17(2): p. 243-54
    [PMID:22147560]