![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G014653_P02 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 84aa MW: 9207.58 Da PI: 7.2908 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 59.8 | 8.9e-19 | 10 | 58 | 1 | 50 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50
lppGfrFhPtdeelv++yL+++++g ++ + +i+e+d+yk++Pw+Lp++
GRMZM2G014653_P02 10 LPPGFRFHPTDEELVMHYLCRRCAGLPIAV-PIIAEIDLYKFDPWQLPST 58
79**************************99.88**************943 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.92E-21 | 7 | 60 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 19.722 | 10 | 84 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.8E-8 | 11 | 53 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009611 | Biological Process | response to wounding | ||||
| GO:0009788 | Biological Process | negative regulation of abscisic acid-activated signaling pathway | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MSGAGPDLQL PPGFRFHPTD EELVMHYLCR RCAGLPIAVP IIAEIDLYKF DPWQLPSTSR 60 RPRSSCSSSS SREPISCAAV TMAS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 2e-23 | 4 | 59 | 9 | 64 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.12113 | 4e-92 | cell culture| meristem| ovary| pedicel| pericarp| pollen| root | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G014653 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10660065}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269|PubMed:17587305, ECO:0000269|PubMed:18273684, ECO:0000269|PubMed:19453457, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00121 | DAP | Transfer from AT1G01720 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G014653_P02 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269|PubMed:11332734, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT054386 | 8e-90 | BT054386.2 Zea mays full-length cDNA clone ZM_BFc0017P07 mRNA, complete cds. | |||
| GenBank | BT060534 | 8e-90 | BT060534.2 Zea mays full-length cDNA clone ZM_BFb0012O13 mRNA, complete cds. | |||
| GenBank | BT063238 | 8e-90 | BT063238.2 Zea mays full-length cDNA clone ZM_BFc0041I22 mRNA, complete cds. | |||
| GenBank | BT064405 | 8e-90 | BT064405.1 Zea mays full-length cDNA clone ZM_BFc0166H07 mRNA, complete cds. | |||
| GenBank | BT065082 | 8e-90 | BT065082.2 Zea mays full-length cDNA clone ZM_BFb0054J18 mRNA, complete cds. | |||
| GenBank | BT067617 | 8e-90 | BT067617.2 Zea mays full-length cDNA clone ZM_BFc0107G18 mRNA, complete cds. | |||
| GenBank | BT069291 | 8e-90 | BT069291.2 Zea mays full-length cDNA clone ZM_BFc0043P04 mRNA, complete cds. | |||
| GenBank | BT085375 | 8e-90 | BT085375.2 Zea mays full-length cDNA clone ZM_BFc0005B20 mRNA, complete cds. | |||
| GenBank | BT085892 | 8e-90 | BT085892.2 Zea mays full-length cDNA clone ZM_BFc0076P05 mRNA, complete cds. | |||
| GenBank | EU956242 | 8e-90 | EU956242.1 Zea mays clone 1559533 NAC domain-containing protein 48 mRNA, complete cds. | |||
| GenBank | HQ858713 | 8e-90 | HQ858713.1 Zea mays clone UT1169 NAC transcription factor mRNA, partial cds. | |||
| GenBank | KP297931 | 8e-90 | KP297931.1 UNVERIFIED: Zea mays Zma003086-like mRNA, complete sequence. | |||
| GenBank | KP900766 | 8e-90 | KP900766.1 Zea mays NAC protein Zma3086 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001266607.2 | 1e-34 | NAC domain-containing protein 48 | ||||
| Swissprot | Q7F2L3 | 3e-32 | NAC48_ORYSJ; NAC domain-containing protein 48 | ||||
| TrEMBL | C0P7Y6 | 2e-34 | C0P7Y6_MAIZE; Uncharacterized protein | ||||
| STRING | GRMZM2G014653_P01 | 5e-34 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G01720.1 | 2e-27 | NAC family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G014653_P02 |




