| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Homeobox | 26 | 1.6e-08 | 288 | 322 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55
k +yps++++ LA+++gL+ +q+ +WF N+R ++
GRMZM2G017087_P02 288 KWPYPSETQKVALAESTGLDLKQINNWFINQRKRH 322
569*****************************885 PP
|
| 2 | ELK | 37.1 | 6.7e-13 | 242 | 263 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22
ELKh+Ll+KYsgyL+sLkqE+s
GRMZM2G017087_P02 242 ELKHHLLKKYSGYLSSLKQELS 263
9*******************97 PP
|
| Publications
? help Back to Top |
- Lowe B,Mathern J,Hake S
Active Mutator elements suppress the knotted phenotype and increase recombination at the Kn1-O tandem duplication. Genetics, 1992. 132(3): p. 813-22 [PMID:1334895] - Smith LG,Greene B,Veit B,Hake S
A dominant mutation in the maize homeobox gene, Knotted-1, causes its ectopic expression in leaf cells with altered fates. Development, 1992. 116(1): p. 21-30 [PMID:1362381] - Vollbrecht E,Veit B,Sinha N,Hake S
The developmental gene Knotted-1 is a member of a maize homeobox gene family. Nature, 1991. 350(6315): p. 241-3 [PMID:1672445] - Alexandrov NN, et al.
Insights into corn genes derived from large-scale cDNA sequencing. Plant Mol. Biol., 2009. 69(1-2): p. 179-94 [PMID:18937034] - Lunde C,Hake S
The interaction of knotted1 and thick tassel dwarf1 in vegetative and reproductive meristems of maize. Genetics, 2009. 181(4): p. 1693-7 [PMID:19153258] - Bolduc N,Hake S
The maize transcription factor KNOTTED1 directly regulates the gibberellin catabolism gene ga2ox1. Plant Cell, 2009. 21(6): p. 1647-58 [PMID:19567707] - Ramirez J,Bolduc N,Lisch D,Hake S
Distal expression of knotted1 in maize leaves leads to reestablishment of proximal/distal patterning and leaf dissection. Plant Physiol., 2009. 151(4): p. 1878-88 [PMID:19854860] - Woodward JB, et al.
A maize thiamine auxotroph is defective in shoot meristem maintenance. Plant Cell, 2010. 22(10): p. 3305-17 [PMID:20971897] - Veit B,Vollbrecht E,Mathern J,Hake S
A tandem duplication causes the Kn1-O allele of Knotted, a dominant morphological mutant of maize. Genetics, 1990. 125(3): p. 623-31 [PMID:2165968] - Xu XM, et al.
Chaperonins facilitate KNOTTED1 cell-to-cell trafficking and stem cell function. Science, 2011. 333(6046): p. 1141-4 [PMID:21868675] - Bolduc N, et al.
Unraveling the KNOTTED1 regulatory network in maize meristems. Genes Dev., 2012. 26(15): p. 1685-90 [PMID:22855831] - Sinha N,Hake S
Mutant characters of knotted maize leaves are determined in the innermost tissue layers. Dev. Biol., 1990. 141(1): p. 203-10 [PMID:2391001] - Eveland AL, et al.
Regulatory modules controlling maize inflorescence architecture. Genome Res., 2014. 24(3): p. 431-43 [PMID:24307553] - Chen H,Jackson D,Kim JY
Identification of evolutionarily conserved amino acid residues in homeodomain of KNOX proteins for intercellular trafficking. Plant Signal Behav, 2014. 9(3): p. e28355 [PMID:24603432] - Sinha NR,Williams RE,Hake S
Overexpression of the maize homeo box gene, KNOTTED-1, causes a switch from determinate to indeterminate cell fates. Genes Dev., 1993. 7(5): p. 787-95 [PMID:7684007] - Greene B,Walko R,Hake S
Mutator insertions in an intron of the maize knotted1 gene result in dominant suppressible mutations. Genetics, 1994. 138(4): p. 1275-85 [PMID:7896105] - Meisel L,Lam E
The conserved ELK-homeodomain of KNOTTED-1 contains two regions that signal nuclear localization. Plant Mol. Biol., 1996. 30(1): p. 1-14 [PMID:8616227] - Mathern J,Hake S
Mu element-generated gene conversions in maize attenuate the dominant knotted phenotype. Genetics, 1997. 147(1): p. 305-14 [PMID:9286690]
|