PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GRMZM2G025685_P02

Common Name

Zm.79780

Organism

Zea mays

Taxonomic ID

4577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

HSF

Protein Properties

Length: 88aa MW: 10223.6 Da PI: 5.5465

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G025685_P02	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	80.8	2.1e-25	27	85	2	60
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y++++d+ +++++sw ++ ++fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y GRMZM2G025685_P02 27 FLTKTYQLVDDPCTDHIVSWGDDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY 85 9*********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	2.3E-27	19	85	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	1.2E-20	23	88	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	3.67E-23	26	85	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	1.8E-21	27	85	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.1E-15	27	50	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.1E-15	65	77	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.1E-15	78	88	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MAFLVERCGE MVVSMESPHA KPVPAPFLTK TYQLVDDPCT DHIVSWGDDD TTFVVWRPPE 60 FARDLLPNYF KHNNFSSFVR QLNTYVRT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2ldu_A	2e-16	23	85	17	78	Heat shock factor protein 1
5d5u_B	2e-16	23	85	26	87	Heat shock factor protein 1
5d5v_B	2e-16	23	85	26	87	Heat shock factor protein 1
5d5v_D	2e-16	23	85	26	87	Heat shock factor protein 1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Zm.79780	1e-137	ear\| tassel

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G025685

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269\|PubMed:16202242}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G025685_P02

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT054148	1e-141	BT054148.1 Zea mays full-length cDNA clone ZM_BFb0133K13 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001144365.2	5e-58	uncharacterized protein LOC100277279
Swissprot	Q7XHZ0	8e-53	HFB4B_ORYSJ; Heat stress transcription factor B-4b
TrEMBL	A0A3L6DVJ5	9e-57	A0A3L6DVJ5_MAIZE; Heat stress transcription factor B-4b
STRING	GRMZM2G025685_P01	5e-58	(Zea mays)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G46264.1	4e-43	heat shock transcription factor B4

Link Out ? help Back to Top
Phytozome	GRMZM2G025685_P02

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]