![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G026223_P07 | ||||||||
| Common Name | LOC100279630 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 189aa MW: 21879.3 Da PI: 9.8695 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 92.6 | 1.9e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien rqvtfskRrng+lKKA+ELSvLCdaeva+++fs++gklye++s
GRMZM2G026223_P07 9 KRIENPASRQVTFSKRRNGLLKKAFELSVLCDAEVALVVFSPRGKLYEFAS 59
79***********************************************86 PP
| |||||||
| 2 | K-box | 52.3 | 2.5e-18 | 78 | 144 | 6 | 72 |
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnel 72
++++++++ e+ + +++ L k++e L+ +R+llGe Le++s++eL++Le +Leksl iR +K +
GRMZM2G026223_P07 78 SNKTAHQDIEQVKADAEGLAKKLEALEAYKRKLLGERLEECSFEELHSLEVKLEKSLHCIRGRKVSY 144
444788999*******************************************************765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 5.8E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 31.076 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.22E-32 | 3 | 81 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.75E-41 | 3 | 75 | No hit | No description |
| Pfam | PF00319 | 3.0E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 8.9E-18 | 82 | 143 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 8.719 | 86 | 181 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 189 aa Download sequence Send to blast |
MVRGKTQMKR IENPASRQVT FSKRRNGLLK KAFELSVLCD AEVALVVFSP RGKLYEFASG 60 SAQKTIERYR TYTKDNVSNK TAHQDIEQVK ADAEGLAKKL EALEAYKRKL LGERLEECSF 120 EELHSLEVKL EKSLHCIRGR KVSYFPHVVL CIQYMYDVLT NELKAAYIHM RIWSYVHGRL 180 SCWRSNSIS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3mu6_A | 6e-19 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 6e-19 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 6e-19 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 6e-19 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
| 6byy_A | 9e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
| 6byy_B | 9e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
| 6byy_C | 9e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
| 6byy_D | 9e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_A | 9e-19 | 1 | 78 | 1 | 78 | MEF2 CHIMERA |
| 6bz1_B | 9e-19 | 1 | 78 | 1 | 78 | MEF2 CHIMERA |
| 6bz1_C | 9e-19 | 1 | 78 | 1 | 78 | MEF2 CHIMERA |
| 6bz1_D | 9e-19 | 1 | 78 | 1 | 78 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.96018 | 0.0 | endosperm| meristem| ovary| pollen| shoot | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G026223 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Low expression in the young panicle continues to decline as the organ mature. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in mature leaves and at low levels in roots and young panicles. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G026223_P07 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT062798 | 0.0 | BT062798.1 Zea mays full-length cDNA clone ZM_BFb0347K21 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008672798.1 | 3e-98 | putative MADS-box transcription factor family protein isoform X1 | ||||
| Swissprot | Q9XJ60 | 5e-87 | MAD50_ORYSJ; MADS-box transcription factor 50 | ||||
| TrEMBL | C0P3C9 | 1e-138 | C0P3C9_MAIZE; Agamous-like6 | ||||
| STRING | GRMZM2G026223_P04 | 1e-97 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G45660.1 | 2e-63 | AGAMOUS-like 20 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G026223_P07 |




