![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G035156_P01 | ||||||||
| Common Name | LOC103631776, Zm.28335 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 92aa MW: 10358.6 Da PI: 7.3653 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 23.3 | 1.1e-07 | 20 | 59 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
+i + ++L++llP+a +++ ++ a +L+++++YI++L
GRMZM2G035156_P01 20 QISDLVSKLQDLLPEARLQSNARVPSARVLQETCNYIRNL 59
789999*********889********************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.280.10 | 7.7E-9 | 3 | 78 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| PROSITE profile | PS50888 | 10.442 | 5 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 3.27E-9 | 18 | 81 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Pfam | PF00010 | 9.1E-5 | 20 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009640 | Biological Process | photomorphogenesis | ||||
| GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
| GO:0080113 | Biological Process | regulation of seed growth | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 92 aa Download sequence Send to blast |
MSNRRSRSRQ SGSSRITEEQ ISDLVSKLQD LLPEARLQSN ARVPSARVLQ ETCNYIRNLH 60 QEVDDLSERL SELLATSDMS SAQAAVIRSL LM |
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G035156 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway (By similarity). {ECO:0000250}. | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway. {ECO:0000269|PubMed:22363621}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G035156_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK069569 | 8e-81 | AK069569.1 Oryza sativa Japonica Group cDNA clone:J023022K12, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008651476.1 | 3e-58 | transcription factor ILI6 | ||||
| Swissprot | B8APB5 | 2e-44 | ILI6_ORYSI; Transcription factor ILI6 | ||||
| Swissprot | Q0DUR2 | 2e-44 | ILI6_ORYSJ; Transcription factor ILI6 | ||||
| TrEMBL | A0A1D6JQ58 | 6e-57 | A0A1D6JQ58_MAIZE; Transcription factor PRE3 | ||||
| TrEMBL | A0A317Y4L4 | 6e-57 | A0A317Y4L4_MAIZE; Transcription factor ILI6 | ||||
| STRING | GRMZM2G035156_P01 | 1e-57 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2675 | 33 | 78 | Representative plant | OGRP1877 | 12 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26945.1 | 4e-32 | bHLH family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G035156_P01 |
| Entrez Gene | 103631776 |




