![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G037630_P01 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 90aa MW: 10062.6 Da PI: 12.3854 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 103.7 | 1.7e-32 | 24 | 78 | 1 | 56 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgG 56
+ep++VNaKQy++Il+RRqkRakle+++kl k+rkpylheSRh+hA++R Rg+gG
GRMZM2G037630_P01 24 EEPIFVNAKQYNAILRRRQKRAKLEAQNKL-VKGRKPYLHESRHRHAMKRVRGPGG 78
69****************************.************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 1.2E-31 | 22 | 83 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 34.312 | 23 | 83 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 1.7E-27 | 25 | 78 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 1.9E-21 | 26 | 48 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 28 | 48 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 1.9E-21 | 57 | 80 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MQVHPQISGA ANTRVPLPVG PAAEEPIFVN AKQYNAILRR RQKRAKLEAQ NKLVKGRKPY 60 LHESRHRHAM KRVRGPGGVS STKRSSRSSS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 1e-20 | 24 | 78 | 2 | 56 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 38 | 45 | RRRQKRAK |
| 2 | 39 | 46 | RRQKRAKL |
| 3 | 64 | 73 | RHRHAMKRVR |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.27942 | 1e-147 | endosperm| root| shoot | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G037630 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G037630_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU961865 | 1e-145 | EU961865.1 Zea mays clone 238735 mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002467701.1 | 5e-46 | nuclear transcription factor Y subunit A-4 | ||||
| Refseq | XP_021304968.1 | 5e-46 | nuclear transcription factor Y subunit A-4 | ||||
| Swissprot | Q9LVJ7 | 1e-31 | NFYA6_ARATH; Nuclear transcription factor Y subunit A-6 | ||||
| TrEMBL | A0A1D6K5I2 | 9e-58 | A0A1D6K5I2_MAIZE; Nuclear transcription factor Y subunit A-8 | ||||
| STRING | GRMZM2G037630_P01 | 1e-58 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1373 | 38 | 121 | Representative plant | OGRP680 | 16 | 72 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G14020.1 | 6e-33 | nuclear factor Y, subunit A6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G037630_P01 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




