![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G041127_P02 | ||||||||
| Common Name | si606017c07 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | HD-ZIP | ||||||||
| Protein Properties | Length: 154aa MW: 17686.1 Da PI: 9.4336 | ||||||||
| Description | HD-ZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 61.7 | 1.2e-19 | 51 | 104 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
k++++++eq+++Le+ Fe ++++ e++++LA+ lgL+ rqV vWFqNrRa++k
GRMZM2G041127_P02 51 KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 104
45689************************************************9 PP
| |||||||
| 2 | HD-ZIP_I/II | 134.7 | 3.2e-43 | 50 | 140 | 1 | 91 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91
ekkrrls+eqv++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+r+ydal+ ++++L++++++L +e+
GRMZM2G041127_P02 50 EKKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRRSYDALRLDHDALRRDKDALLAEV 140
69*************************************************************************************9887 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 2.21E-20 | 40 | 108 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50071 | 17.475 | 46 | 106 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 1.5E-18 | 49 | 110 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 7.98E-16 | 51 | 107 | No hit | No description |
| Pfam | PF00046 | 5.5E-17 | 51 | 104 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 1.6E-20 | 52 | 113 | IPR009057 | Homeodomain-like |
| PRINTS | PR00031 | 4.0E-6 | 77 | 86 | IPR000047 | Helix-turn-helix motif |
| PROSITE pattern | PS00027 | 0 | 81 | 104 | IPR017970 | Homeobox, conserved site |
| PRINTS | PR00031 | 4.0E-6 | 86 | 102 | IPR000047 | Helix-turn-helix motif |
| Pfam | PF02183 | 5.6E-15 | 106 | 141 | IPR003106 | Leucine zipper, homeobox-associated |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 154 aa Download sequence Send to blast |
MKRPRGATPS LSAMPNHQED DGYGVLGMEA DVDVDVDEEM MAFGGGGGGE KKRRLSAEQV 60 RALERSFEVE NKLEPERKAR LARDLGLQPR QVAVWFQNRR ARWKTKQLER DYAALRRSYD 120 ALRLDHDALR RDKDALLAEV VLSITPYYIC RRIV |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 75 | 81 | ERKARLA |
| 2 | 98 | 106 | RRARWKTKQ |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.84749 | 0.0 | ear| endosperm| meristem| ovary | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G041127 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in leaf and floral organ primordia, floral meristems, embryonic axis and cells surrounding the vascular bundles. Expressed in the vasculature of roots, stem, leaves and spikelets, and in the vascular bundle of the scutellum in embryos. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in leaf and floral organ primordia, floral meristems, embryonic axis and cells surrounding the vascular bundles. Expressed in the vasculature of roots, stem, leaves and spikelets, and in the vascular bundle of the scutellum in embryos. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:18049796}. | |||||
| UniProt | Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:18049796}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G041127_P02 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. | |||||
| UniProt | INDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT036856 | 0.0 | BT036856.2 Zea mays full-length cDNA clone ZM_BFb0143M01 mRNA, complete cds. | |||
| GenBank | BT054500 | 0.0 | BT054500.1 Zea mays full-length cDNA clone ZM_BFc0103D23 mRNA, complete cds. | |||
| GenBank | JX469932 | 0.0 | JX469932.1 Zea mays subsp. mays clone UT3191 HB-type transcription factor mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001132844.1 | 3e-95 | uncharacterized protein LOC100194336 | ||||
| Swissprot | Q6K498 | 1e-68 | HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4 | ||||
| Swissprot | Q9XH37 | 1e-68 | HOX4_ORYSI; Homeobox-leucine zipper protein HOX4 | ||||
| TrEMBL | B4FIB8 | 8e-94 | B4FIB8_MAIZE; Homeobox-leucine zipper protein ATHB-6 | ||||
| TrEMBL | K4JBR7 | 8e-94 | K4JBR7_MAIZE; HB-type transcription factor (Fragment) | ||||
| STRING | GRMZM2G041127_P04 | 2e-78 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G40060.1 | 1e-43 | homeobox protein 16 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G041127_P02 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




