PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GRMZM2G041415_P01

Common Name

myb8, Zm.17476

Organism

Zea mays

Taxonomic ID

4577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

MYB

Protein Properties

Length: 226aa MW: 24238.1 Da PI: 8.8924

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G041415_P01	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.5	1.3e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv ++k +G g+W++ ++ g+ R++k+c++rw +yl GRMZM2G041415_P01 14 KGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	56.3	7.4e-18	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T+eEd+ ++++++ lG++ W++Ia+ ++ gRt++++k++w+++ GRMZM2G041415_P01 67 RGNFTQEEDDVIIKLHQVLGNK-WSLIAAQLP-GRTDNEIKNYWNTH 111 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	4.1E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.922	9	61	IPR017930	Myb domain
SMART	SM00717	1.2E-13	13	63	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.82E-30	13	108	IPR009057	Homeodomain-like
Pfam	PF00249	2.3E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	6.20E-11	16	61	No hit	No description
PROSITE profile	PS51294	28.063	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	5.6E-29	65	117	IPR009057	Homeodomain-like
SMART	SM00717	1.7E-16	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	6.6E-16	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	5.07E-12	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 226 aa Download sequence Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLVAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF TQEEDDVIIK LHQVLGNKWS LIAAQLPGRT DNEIKNYWNT HIKRKLIARG 120 IDPRTHQPAS AAAVAPAAAA AAAAQSSFRH HGDDEAVARR SCSRDSGCIA AHSSDDDDST 180 SGSLPHQHAV GGIDLNLSLS PPTSQPSSPA AAKGVVASGY GQGSES

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-31	14	116	7	108	B-MYB
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Zm.17476	0.0	meristem

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G041415

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, flower buds, and siliques. {ECO:0000269\|PubMed:9839469}.
Uniprot	TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G041415_P01

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By ethylene, asbscisic acid (ABA), auxin (IAA), and Pseudomonas syringae pv. phaseolica. {ECO:0000269\|PubMed:9839469}.
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM156905	0.0	AM156905.1 Zea mays mRNA for transcription factor MYB8 (myb8 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001106037.1	1e-167	transcription factor MYB8
Swissprot	Q38851	5e-87	MYB6_ARATH; Transcription repressor MYB6
Swissprot	Q9SZP1	1e-86	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A3L6FJM8	1e-165	A0A3L6FJM8_MAIZE; Transcription repressor MYB4
TrEMBL	Q2A703	1e-165	Q2A703_MAIZE; Myb transcription factor8
STRING	GRMZM2G041415_P01	1e-166	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	8e-87	myb domain protein 4

Link Out ? help Back to Top
Phytozome	GRMZM2G041415_P01
Entrez Gene	100125635

Publications ? help Back to Top
Fornalé S, et al. Down-regulation of the maize and Arabidopsis thaliana caffeic acid O-methyl-transferase genes by two new maize R2R3-MYB transcription factors. Plant Mol. Biol., 2006. 62(6): p. 809-23 [PMID:16941210] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]