![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G042494_P01 | ||||||||
| Common Name | LOC103639176, ZEAMMB73_655996 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 241aa MW: 26619.3 Da PI: 9.2354 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 172.2 | 1.5e-53 | 10 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92
lppGfrFhPtdeel+v+yL+++++++++++ +i++vdiyk++PwdLp++++ ++kewyfFs+rd+ky++g r+nra+ sgyWkatg+dk++
GRMZM2G042494_P01 10 LPPGFRFHPTDEELIVNYLRNRAANTPCPV-AIIADVDIYKLDPWDLPSRAAYGDKEWYFFSPRDRKYPNGVRPNRAAGSGYWKATGTDKPI 100
79****************************.88***************888889************************************** PP
NAM 93 lsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
+ + +g++vg+kk Lvfykgr pkg kt+W+mheyrl
GRMZM2G042494_P01 101 HGSatGGSVVGVKKALVFYKGRPPKGAKTNWIMHEYRL 138
998889999***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 5.36E-65 | 8 | 173 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 62.015 | 10 | 173 | IPR003441 | NAC domain |
| Pfam | PF02365 | 8.3E-28 | 11 | 138 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009825 | Biological Process | multidimensional cell growth | ||||
| GO:0009835 | Biological Process | fruit ripening | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0010150 | Biological Process | leaf senescence | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 241 aa Download sequence Send to blast |
MIKANPDSML PPGFRFHPTD EELIVNYLRN RAANTPCPVA IIADVDIYKL DPWDLPSRAA 60 YGDKEWYFFS PRDRKYPNGV RPNRAAGSGY WKATGTDKPI HGSATGGSVV GVKKALVFYK 120 GRPPKGAKTN WIMHEYRLAA ADAHAAHSYY RSMKSRNASM RLDDWVLCRI YKKASHVPPM 180 AVPPLSDHEQ DEPCGFDENP YGATTSAAVL LQGASCPALQ AAAGVQRMPR IPSLTELFSD 240 P |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 4e-72 | 10 | 175 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 4e-72 | 10 | 175 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 4e-72 | 10 | 175 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 4e-72 | 10 | 175 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 4e-72 | 10 | 175 | 20 | 170 | NAC domain-containing protein 19 |
| 3swm_B | 4e-72 | 10 | 175 | 20 | 170 | NAC domain-containing protein 19 |
| 3swm_C | 4e-72 | 10 | 175 | 20 | 170 | NAC domain-containing protein 19 |
| 3swm_D | 4e-72 | 10 | 175 | 20 | 170 | NAC domain-containing protein 19 |
| 3swp_A | 4e-72 | 10 | 175 | 20 | 170 | NAC domain-containing protein 19 |
| 3swp_B | 4e-72 | 10 | 175 | 20 | 170 | NAC domain-containing protein 19 |
| 3swp_C | 4e-72 | 10 | 175 | 20 | 170 | NAC domain-containing protein 19 |
| 3swp_D | 4e-72 | 10 | 175 | 20 | 170 | NAC domain-containing protein 19 |
| 4dul_A | 4e-72 | 10 | 175 | 17 | 167 | NAC domain-containing protein 19 |
| 4dul_B | 4e-72 | 10 | 175 | 17 | 167 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G042494 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed at the base of the inflorescence meristem and at late stages of development in petals and stamens. Up-regulated during leaf senescence. {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:9489703}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in senescing leaves, petals and sepals. {ECO:0000269|PubMed:16640597}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:25516602}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00221 | DAP | Transfer from AT1G69490 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G042494_P01 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:24659488, ECO:0000269|PubMed:25516602, ECO:0000269|PubMed:9489703}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ728029 | 0.0 | KJ728029.1 Zea mays clone pUT6168 NAC transcription factor (NAC44) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025798103.1 | 1e-140 | NAC domain-containing protein 10-like | ||||
| Swissprot | O49255 | 1e-83 | NAC29_ARATH; NAC transcription factor 29 | ||||
| TrEMBL | A0A3L6DE02 | 1e-165 | A0A3L6DE02_MAIZE; NAC transcription factor 29 | ||||
| STRING | GRMZM2G042494_P01 | 1e-180 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1237 | 36 | 123 | Representative plant | OGRP17 | 15 | 800 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69490.1 | 2e-84 | NAC-like, activated by AP3/PI | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G042494_P01 |
| Entrez Gene | 103639176 |




