![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G044752_P03 | ||||||||
| Common Name | HB53, LOC100285975 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | HD-ZIP | ||||||||
| Protein Properties | Length: 187aa MW: 20556.4 Da PI: 8.9219 | ||||||||
| Description | HD-ZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 62 | 9.2e-20 | 36 | 90 | 2 | 56 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
rk+ +++k+q +Le+ F+++++++ ++++ LA++lgL rqV vWFqNrRa+ k
GRMZM2G044752_P03 36 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRPRQVEVWFQNRRARTK 90
788899***********************************************98 PP
| |||||||
| 2 | HD-ZIP_I/II | 130.9 | 5.1e-42 | 36 | 125 | 1 | 91 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91
+kk+rlsk+q+++LE+sF+e+ +L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
GRMZM2G044752_P03 36 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKEVQELR-AL 125
69*************************************************************************************9.55 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 3.8E-19 | 27 | 93 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50071 | 17.313 | 32 | 92 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 7.4E-18 | 34 | 96 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 1.12E-16 | 36 | 93 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 4.8E-19 | 36 | 90 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 4.3E-17 | 36 | 90 | IPR001356 | Homeobox domain |
| PRINTS | PR00031 | 2.9E-6 | 63 | 72 | IPR000047 | Helix-turn-helix motif |
| PROSITE pattern | PS00027 | 0 | 67 | 90 | IPR017970 | Homeobox, conserved site |
| PRINTS | PR00031 | 2.9E-6 | 72 | 88 | IPR000047 | Helix-turn-helix motif |
| Pfam | PF02183 | 1.6E-11 | 92 | 126 | IPR003106 | Leucine zipper, homeobox-associated |
| SMART | SM00340 | 2.7E-25 | 92 | 135 | IPR003106 | Leucine zipper, homeobox-associated |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0008283 | Biological Process | cell proliferation | ||||
| GO:0009641 | Biological Process | shade avoidance | ||||
| GO:0009733 | Biological Process | response to auxin | ||||
| GO:0009735 | Biological Process | response to cytokinin | ||||
| GO:0009826 | Biological Process | unidimensional cell growth | ||||
| GO:0010016 | Biological Process | shoot system morphogenesis | ||||
| GO:0010017 | Biological Process | red or far-red light signaling pathway | ||||
| GO:0010218 | Biological Process | response to far red light | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0048364 | Biological Process | root development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 187 aa Download sequence Send to blast |
MPLLLPAKRT TEVTGEDGLR GGSDEEDGGC GIDGSRKKLR LSKDQSAVLE DSFREHPTLN 60 PRQKAALAQQ LGLRPRQVEV WFQNRRARTK LKQTEVDCEY LKRCCETLTE ENRRLQKEVQ 120 ELRALKLVSP HLYMHMSPPT TLTMCPSCER VSSSNGNSAA ATAAARARAG AGAGAIVCHP 180 IDRATST |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 34 | 40 | SRKKLRL |
| 2 | 84 | 92 | RRARTKLKQ |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.21339 | 0.0 | meristem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G044752 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G044752_P03 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU974980 | 0.0 | EU974980.1 Zea mays clone 462177 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001152336.1 | 1e-136 | uncharacterized protein LOC100285975 | ||||
| Swissprot | Q01I23 | 2e-87 | HOX17_ORYSI; Homeobox-leucine zipper protein HOX17 | ||||
| TrEMBL | A0A3L6G2G6 | 1e-135 | A0A3L6G2G6_MAIZE; Homeobox-leucine zipper protein HOX17 | ||||
| TrEMBL | B6UCL5 | 1e-135 | B6UCL5_MAIZE; HB transcription factor | ||||
| STRING | GRMZM2G044752_P01 | 1e-136 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G60390.1 | 1e-74 | homeobox-leucine zipper protein 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G044752_P03 |
| Entrez Gene | 100285975 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




