![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G045977_P01 | ||||||||
| Common Name | Zm.162576 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | GRF | ||||||||
| Protein Properties | Length: 221aa MW: 23008.2 Da PI: 9.8468 | ||||||||
| Description | GRF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRC | 81 | 1e-25 | 130 | 174 | 1 | 45 |
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45
++epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr rsrk++e+
GRMZM2G045977_P01 130 EPEPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKPVEA 174
69****************************************985 PP
| |||||||
| 2 | QLQ | 54.1 | 4.7e-19 | 64 | 100 | 1 | 37 |
QLQ 1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
sa+T +Q q+L++Q+l+y+y+aa++PvP++L+++i+k
GRMZM2G045977_P01 64 SALTFMQQQELEHQVLIYRYFAAGAPVPAHLVLPIWK 100
799*********************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00951 | 7.2E-7 | 64 | 100 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
| PROSITE profile | PS51666 | 21.122 | 65 | 100 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
| Pfam | PF08880 | 1.7E-11 | 65 | 99 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
| PROSITE profile | PS51667 | 25.701 | 130 | 174 | IPR014977 | WRC domain |
| Pfam | PF08879 | 3.1E-21 | 131 | 173 | IPR014977 | WRC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0006995 | Biological Process | cellular response to nitrogen starvation | ||||
| GO:0008285 | Biological Process | negative regulation of cell proliferation | ||||
| GO:0009624 | Biological Process | response to nematode | ||||
| GO:0009631 | Biological Process | cold acclimation | ||||
| GO:0016036 | Biological Process | cellular response to phosphate starvation | ||||
| GO:0048364 | Biological Process | root development | ||||
| GO:0048366 | Biological Process | leaf development | ||||
| GO:0050826 | Biological Process | response to freezing | ||||
| GO:0051365 | Biological Process | cellular response to potassium ion starvation | ||||
| GO:0061062 | Biological Process | regulation of nematode larval development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005737 | Cellular Component | cytoplasm | ||||
| GO:0005524 | Molecular Function | ATP binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 221 aa Download sequence Send to blast |
MAAEDKETDS PQPPAKLPRL SCADTSAGVA ASSPLVLGLG LGLGGGGERD ADASPATATP 60 KRPSALTFMQ QQELEHQVLI YRYFAAGAPV PAHLVLPIWK SVAASSFGPQ RFPSLMGLGS 120 LCFDYRSSME PEPGRCRRTD GKKWRCSRDV VPGHKYCERH VHRGRGRSRK PVEAAAPAPS 180 AAAATSLGGG PVHHTGGAPP PHGLGLSPTS VLLAHSAARA T |
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G045977 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G045977_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU965972 | 0.0 | EU965972.1 Zea mays clone 290465 mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008646054.1 | 1e-157 | growth-regulating factor 10 | ||||
| Swissprot | Q6EPP9 | 4e-92 | GRF10_ORYSJ; Growth-regulating factor 10 | ||||
| TrEMBL | A0A1D6HFX6 | 1e-156 | A0A1D6HFX6_MAIZE; Uncharacterized protein | ||||
| STRING | GRMZM2G045977_P01 | 1e-157 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6221 | 30 | 51 | Representative plant | OGRP460 | 16 | 84 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G36400.1 | 4e-38 | growth-regulating factor 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G045977_P01 |
| Entrez Gene | 103627547 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




