PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G056929_P01
Common NameLOC103646512
Organism
Zea mays
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family S1Fa-like
Protein Properties Length: 56aa    MW: 6310.77 Da    PI: 10.9368
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G056929_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA111.44.3e-351561570
               S1FA 15 livllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                       ++vllvv+++ll+f+vgny++yvyaqk+lPP+kkkPvskkklkreklkqGv++PGe
  GRMZM2G056929_P01  1 MVVLLVVASFLLLFFVGNYAMYVYAQKTLPPKKKKPVSKKKLKREKLKQGVSAPGE 56
                       89*****************************************************8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046891.1E-32156IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 56 aa     Download sequence    Send to blast
MVVLLVVASF LLLFFVGNYA MYVYAQKTLP PKKKKPVSKK KLKREKLKQG VSAPGE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.946808e-86ear| embryo| endosperm| meristem| ovary| pedicel| root| sheath| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G056929
Functional Description ? help Back to Top
Source Description
UniProtDNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G056929_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9553892e-83EU955389.1 Zea mays clone 1530645 DNA-binding protein S1FA2 mRNA, complete cds.
GenBankEU9587882e-83EU958788.1 Zea mays clone 207858 DNA-binding protein S1FA2 mRNA, complete cds.
GenBankEU9638702e-83EU963870.1 Zea mays clone 273675 DNA-binding protein S1FA2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001316616.12e-31DNA-binding protein S1FA
SwissprotQ7XLX62e-15S1FA2_ORYSJ; DNA-binding protein S1FA2
TrEMBLA0A1D6EBT54e-30A0A1D6EBT5_MAIZE; DNA-binding protein S1FA
STRINGGRMZM2G056929_P027e-31(Zea mays)
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]