![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G057131_P04 | ||||||||
| Common Name | LOC100284670 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | Nin-like | ||||||||
| Protein Properties | Length: 257aa MW: 29320.6 Da PI: 8.4754 | ||||||||
| Description | Nin-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | RWP-RK | 86.2 | 2.9e-27 | 124 | 173 | 3 | 52 |
RWP-RK 3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
++i+l d+++yF+lpi+dA+k+L++++++LKr+CRqyGI+RWPhRkiksl
GRMZM2G057131_P04 124 DSITLVDIAQYFHLPIRDASKTLKIGVSILKRKCRQYGIPRWPHRKIKSL 173
689*********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51519 | 19.645 | 108 | 194 | IPR003035 | RWP-RK domain |
| Pfam | PF02042 | 3.4E-22 | 125 | 173 | IPR003035 | RWP-RK domain |
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 257 aa Download sequence Send to blast |
MDAAVSTLTA LAIFASTVEH GRCRPPPRFL NCFPPGPGAP HDMNPQLQYL SNLYNDLLMV 60 FRFREEKTVP QLVNSKQPIR CGEQGKTSDL GDASESDSDG DCQSGKELAP PVQKHTRANR 120 KHIDSITLVD IAQYFHLPIR DASKTLKIGV SILKRKCRQY GIPRWPHRKI KSLDSLIHDL 180 EFVLAREDED EEEEKQLQKD RLAAAINALT KRKSMLESEK ETIQQKPAMD LMAETKLFRE 240 DVFKRRYRAK SSVMDMD |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.10901 | 0.0 | cell lignification| endosperm| meristem| tassel | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G057131 | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G057131_P04 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT037348 | 0.0 | BT037348.1 Zea mays full-length cDNA clone ZM_BFb0165E20 mRNA, complete cds. | |||
| GenBank | EU969263 | 0.0 | EU969263.1 Zea mays clone 327733 RWP-RK domain containing protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001151037.1 | 1e-148 | RWP-RK domain containing protein | ||||
| TrEMBL | A0A3L6FPX9 | 1e-147 | A0A3L6FPX9_MAIZE; Protein RKD5 | ||||
| TrEMBL | F1DK11 | 1e-147 | F1DK11_MAIZE; NLP transcription factor (Fragment) | ||||
| STRING | GRMZM2G057131_P02 | 1e-146 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G35590.1 | 5e-36 | RWP-RK domain-containing protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G057131_P04 |




