![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G061101_P02 | ||||||||
| Common Name | LOC100193050 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | TALE | ||||||||
| Protein Properties | Length: 207aa MW: 23395.1 Da PI: 7.7448 | ||||||||
| Description | TALE family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 28.2 | 3.1e-09 | 124 | 157 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55
+yps+ e++ LA+++gL+ +q+ +WF N+R ++
GRMZM2G061101_P02 124 WPYPSELEKAALAESTGLDAKQINNWFINQRKRH 157
69*****************************885 PP
| |||||||
| 2 | ELK | 38.2 | 3e-13 | 77 | 98 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22
ELK++Ll+KYsgyL+sL+ E+s
GRMZM2G061101_P02 77 ELKNHLLNKYSGYLSSLWRELS 98
9*******************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM01256 | 7.2E-13 | 1 | 38 | IPR005541 | KNOX2 |
| Pfam | PF03791 | 1.0E-14 | 1 | 36 | IPR005541 | KNOX2 |
| Pfam | PF03789 | 8.6E-11 | 77 | 98 | IPR005539 | ELK domain |
| PROSITE profile | PS51213 | 10.58 | 77 | 97 | IPR005539 | ELK domain |
| SMART | SM01188 | 2.8E-7 | 77 | 98 | IPR005539 | ELK domain |
| PROSITE profile | PS50071 | 12.471 | 97 | 160 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 2.4E-11 | 99 | 164 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 1.54E-18 | 99 | 166 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 1.22E-12 | 100 | 160 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 8.4E-26 | 102 | 161 | IPR009057 | Homeodomain-like |
| Pfam | PF05920 | 3.5E-16 | 117 | 156 | IPR008422 | Homeobox KN domain |
| PROSITE pattern | PS00027 | 0 | 135 | 158 | IPR017970 | Homeobox, conserved site |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 207 aa Download sequence Send to blast |
MEIYCHMLVR YRQELTRPIQ EADEFFKSME AQIDSFSLDD NGYEEGGGSS DEDEQETVDL 60 GGLPVPETGS PSGEGKELKN HLLNKYSGYL SSLWRELSRK KKKGKLPRDA RQKLLHWWQL 120 HYRWPYPSEL EKAALAESTG LDAKQINNWF INQRKRHWKP APPTMALGTP DYRMGQHGGG 180 ASSSSASAGL RVQGQYFTGG SSYPRGP |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.6585 | 0.0 | endosperm| glume| meristem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G061101 | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G061101_P02 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT035205 | 0.0 | BT035205.1 Zea mays full-length cDNA clone ZM_BFb0044N12 mRNA, complete cds. | |||
| GenBank | BT040622 | 0.0 | BT040622.1 Zea mays full-length cDNA clone ZM_BFc0104L02 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001131690.1 | 1e-153 | uncharacterized protein LOC100193050 isoform 1 | ||||
| Refseq | NP_001336606.1 | 1e-153 | uncharacterized protein LOC100193050 isoform 2 | ||||
| Swissprot | Q75LX7 | 8e-97 | KNOS4_ORYSJ; Homeobox protein knotted-1-like 4 | ||||
| TrEMBL | B4FDL7 | 1e-151 | B4FDL7_MAIZE; HB transcription factor | ||||
| TrEMBL | B4FU34 | 1e-151 | B4FU34_MAIZE; Uncharacterized protein | ||||
| STRING | GRMZM2G061101_P01 | 1e-152 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G08150.1 | 3e-56 | KNOTTED-like from Arabidopsis thaliana | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G061101_P02 |
| Entrez Gene | 100193050 |




