![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G069047_P02 | ||||||||
| Common Name | LOC100272652, ZEAMMB73_863482 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 100aa MW: 11642.4 Da PI: 10.6325 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 105.4 | 7.1e-33 | 25 | 97 | 55 | 128 |
NAM 55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
+++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++s + +g++ktLvfy+grap+g+k+dW+mheyrl
GRMZM2G069047_P02 25 QNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYS-AVRRMGMRKTLVFYRGRAPHGHKSDWIMHEYRL 97
579*************************************.8899***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 32.722 | 1 | 100 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 4.84E-32 | 23 | 100 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.2E-16 | 26 | 97 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009809 | Biological Process | lignin biosynthetic process | ||||
| GO:0009834 | Biological Process | plant-type secondary cell wall biogenesis | ||||
| GO:0009901 | Biological Process | anther dehiscence | ||||
| GO:0010047 | Biological Process | fruit dehiscence | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 100 aa Download sequence Send to blast |
MALIIGVSYR FCVHAERCKI GSGPQNDWYF FSHKDKKYPT GTRTNRATAA GFWKATGRDK 60 AIYSAVRRMG MRKTLVFYRG RAPHGHKSDW IMHEYRLDDP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3swm_A | 3e-28 | 25 | 100 | 73 | 148 | NAC domain-containing protein 19 |
| 3swm_B | 3e-28 | 25 | 100 | 73 | 148 | NAC domain-containing protein 19 |
| 3swm_C | 3e-28 | 25 | 100 | 73 | 148 | NAC domain-containing protein 19 |
| 3swm_D | 3e-28 | 25 | 100 | 73 | 148 | NAC domain-containing protein 19 |
| 3swp_A | 3e-28 | 25 | 100 | 73 | 148 | NAC domain-containing protein 19 |
| 3swp_B | 3e-28 | 25 | 100 | 73 | 148 | NAC domain-containing protein 19 |
| 3swp_C | 3e-28 | 25 | 100 | 73 | 148 | NAC domain-containing protein 19 |
| 3swp_D | 3e-28 | 25 | 100 | 73 | 148 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G069047 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in various aboveground tissues undergoing thickening of the lignified secondary wall such as anthers, filaments of stamens, the base of carpels, styles, the boundaries between siliques and pedicels, the midrib of leaf veins, and inflorescence stems, specifically in interfascicular fibers (sclerenchyma), cells differentiating into vascular vessels, and xylary fibers (secondary xylem). {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00321 | DAP | Transfer from AT2G46770 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G069047_P02 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT039113 | 1e-141 | BT039113.1 Zea mays full-length cDNA clone ZM_BFb0371D07 mRNA, complete cds. | |||
| GenBank | JN634078 | 1e-141 | JN634078.1 Zea mays secondary wall NAC transcription factor 2 mRNA, complete cds. | |||
| GenBank | KJ727685 | 1e-141 | KJ727685.1 Zea mays clone pUT5624 NAC transcription factor (NAC115) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008676756.1 | 3e-64 | secondary wall NAC transcription factor 2 isoform X1 | ||||
| Swissprot | Q84WP6 | 2e-53 | NAC43_ARATH; NAC domain-containing protein 43 | ||||
| TrEMBL | A0A3L6F752 | 1e-55 | A0A3L6F752_MAIZE; NAC domain-containing protein 43 | ||||
| TrEMBL | B4FPS5 | 1e-55 | B4FPS5_MAIZE; NAC domain-containing protein 43 | ||||
| STRING | GRMZM2G069047_P01 | 2e-56 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G46770.1 | 5e-45 | NAC family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G069047_P02 |




