PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GRMZM2G071112_P01

Common Name

LOC100285819

Organism

Zea mays

Taxonomic ID

4577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

ZF-HD

Protein Properties

Length: 89aa MW: 9802.04 Da PI: 7.9935

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G071112_P01	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	98.1	6.7e-31	18	76	1	60
ZF-HD_dimer 1 kekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +++vrY +C++NhAas+GghavDGC+Ef+++ geegt+ alkCaACgCHR+FHRr +++e GRMZM2G071112_P01 18 CCSVRYGDCRRNHAASTGGHAVDGCREFIAE-GEEGTSGALKCAACGCHRSFHRRVQVYE 76 5789************************8.999******************99876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	1.0E-24	1	79	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	8.5E-30	21	73	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	2.6E-23	22	71	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.274	23	72	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MKRLLILQRC EPIVRFSCCS VRYGDCRRNH AASTGGHAVD GCREFIAEGE EGTSGALKCA 60 ACGCHRSFHR RVQVYEVAWG YGSDTSSTE

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Zm.127898	1e-152	shoot

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G071112

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G071112_P01

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU974156	1e-149	EU974156.1 Zea mays clone 441364 mini zinc finger 3 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023156305.1	5e-60	mini zinc finger 3 isoform X1
Swissprot	Q6ER22	1e-31	MIF3_ORYSJ; Mini zinc finger protein 2
TrEMBL	A0A1D6I496	6e-59	A0A1D6I496_MAIZE; Mini zinc finger 3
TrEMBL	A0A3L6E141	5e-59	A0A3L6E141_MAIZE; Mini zinc finger protein 2
STRING	GRMZM2G071112_P01	3e-59	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1431	34	120
Representative plant	OGRP91	16	237

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	7e-25	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	GRMZM2G071112_P01
Entrez Gene	100285819

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Alexandrov NN, et al. Insights into corn genes derived from large-scale cDNA sequencing. Plant Mol. Biol., 2009. 69(1-2): p. 179-94 [PMID:18937034]