PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GRMZM2G072582_P03

Common Name

Zm.578

Organism

Zea mays

Taxonomic ID

4577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

M-type_MADS

Protein Properties

Length: 149aa MW: 17308.3 Da PI: 9.7593

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G072582_P03	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	103.4	7.9e-33	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRrng+lKKA+E+SvLCdaevavi+fs++gklyey+s GRMZM2G072582_P03 9 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAVIVFSPKGKLYEYAS 59 79***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.123	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.8E-43	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.22E-36	2	90	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.16E-43	2	76	No hit	No description
PRINTS	PR00404	1.0E-32	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.6E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.0E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.0E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 149 aa Download sequence Send to blast
MGRGKVQLKR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVAVIVFSP KGKLYEYASD 60 SRMDKILERY ERYSYAEKAL ISAESESEVR SQVVKFSMHL TLFHAPSRQC FINYYHTFCM 120 SKIALVCENM CKFSFCVFLN KTISIVQTI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6bz1_A	5e-23	1	74	1	73	MEF2 CHIMERA
6bz1_B	5e-23	1	74	1	73	MEF2 CHIMERA
6bz1_C	5e-23	1	74	1	73	MEF2 CHIMERA
6bz1_D	5e-23	1	74	1	73	MEF2 CHIMERA
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Zm.578	1e-148	ear\| ovary\| tassel

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G072582

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in the floral meristem at very early stage of the spikelet (rice flower) development. Expressed in lemmas, paleas and lodicules from early to late stage of flower development. {ECO:0000269\|PubMed:10945340}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G072582_P03

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF112150	1e-146	AF112150.1 Zea mays MADS box protein 3 (mads3) mRNA, complete cds.
GenBank	EU961835	1e-146	EU961835.1 Zea mays clone 238496 MADS-box transcription factor 15 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001104927.2	1e-56	MADS3
Swissprot	Q6Q9I2	1e-55	MAD15_ORYSJ; MADS-box transcription factor 15
TrEMBL	A0A1D6HRI1	1e-106	A0A1D6HRI1_MAIZE; MADS3
STRING	Pavir.Ba03990.1.p	2e-57	(Panicum virgatum)
STRING	GRMZM2G072582_P02	4e-56	(Zea mays)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69120.1	1e-46	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	GRMZM2G072582_P03

Publications ? help Back to Top
Cai Q, et al. [PAEs in composts of municipal sludge and rice straw]. Ying Yong Sheng Tai Xue Bao, 2003. 14(11): p. 1993-6 [PMID:14997664] Wang K, et al. DEP and AFO regulate reproductive habit in rice. PLoS Genet., 2010. 6(1): p. e1000818 [PMID:20107517] Kobayashi K, et al. Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene. Plant Cell, 2012. 24(5): p. 1848-59 [PMID:22570445] Ramanujam R,Yishi X,Liu H,Naqvi NI Structure-function analysis of Rgs1 in Magnaporthe oryzae: role of DEP domains in subcellular targeting. PLoS ONE, 2012. 7(7): p. e41084 [PMID:22927898] Ang TN,Ngoh GC,Chua AS,Lee MG Elucidation of the effect of ionic liquid pretreatment on rice husk via structural analyses. Biotechnol Biofuels, 2012. 5(1): p. 67 [PMID:22958710] Zhang G,Huang K,Jiang X,Huang D,Yang Y Acetylation of rice straw for thermoplastic applications. Carbohydr Polym, 2013. 96(1): p. 218-26 [PMID:23688473] Wei X, et al. Fine mapping of BH1, a gene controlling lemma and palea development in rice. Plant Cell Rep., 2013. 32(9): p. 1455-63 [PMID:23689259] Hu S, et al. A point mutation in the zinc finger motif of RID1/EHD2/OsID1 protein leads to outstanding yield-related traits in japonica rice variety Wuyunjing 7. Rice (N Y), 2013. 6(1): p. 24 [PMID:24280027] Ji Y, et al. A comprehensive assessment of human exposure to phthalates from environmental media and food in Tianjin, China. J. Hazard. Mater., 2014. 279: p. 133-40 [PMID:25051237] Huang Y, et al. Phthalates in Commercial Chinese Rice Wines: Concentrations and the Cumulative Risk Assessment to Adult Males in Shanghai. Biomed. Environ. Sci., 2014. 27(10): p. 819-23 [PMID:25341819] Tamaki S, et al. FT-like proteins induce transposon silencing in the shoot apex during floral induction in rice. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(8): p. E901-10 [PMID:25675495] Wu F, et al. The ABCs of flower development: mutational analysis of AP1/FUL-like genes in rice provides evidence for a homeotic (A)-function in grasses. Plant J., 2017. 89(2): p. 310-324 [PMID:27689766]