![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G074543_P01 | ||||||||
| Common Name | Zm.11824 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 109aa MW: 11977.7 Da PI: 7.8411 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 75.4 | 1.8e-23 | 25 | 61 | 134 | 170 |
YABBY 134 keeiqrikasnPdishreafsaaaknWahfPkihfgl 170
++eiqrika+nP+ishreafsaaaknWahfP+ihfgl
GRMZM2G074543_P01 25 RDEIQRIKAGNPNISHREAFSAAAKNWAHFPHIHFGL 61
78*********************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 1.3E-21 | 25 | 61 | IPR006780 | YABBY protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
MHRSDVSLLL FFFLLALSLG EYDCRDEIQR IKAGNPNISH REAFSAAAKN WAHFPHIHFG 60 LMPDHQGLKT TSLLPQDHQR KDGLLKEGLY AAAAAAAAHA AANMGIAPY |
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G074543 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in shoot apex and young inflorescences. {ECO:0000269|PubMed:17216490}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G074543_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY313903 | 1e-141 | AY313903.1 Zea mays yabby9 protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001105231.1 | 5e-55 | yabby 9 | ||||
| Swissprot | Q8L556 | 6e-44 | YAB3_ORYSJ; Protein YABBY 3 | ||||
| TrEMBL | A0A1D6GNF3 | 9e-54 | A0A1D6GNF3_MAIZE; Yabby9 protein | ||||
| TrEMBL | Q7X9M7 | 1e-53 | Q7X9M7_MAIZE; Yabby9 protein | ||||
| STRING | GRMZM2G074543_P04 | 7e-54 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G45190.1 | 2e-29 | YABBY family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G074543_P01 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




