![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G074543_P02 | ||||||||
| Common Name | Zm.11824 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 165aa MW: 17011.3 Da PI: 7.5742 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 81.1 | 3.3e-25 | 46 | 97 | 5 | 56 |
YABBY 5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasql 56
++eq+Cyv+C fC+t+l+vsvP++slfk+vtvrCGhC+sll+v+++
GRMZM2G074543_P02 46 PAAEQLCYVHCYFCDTVLVVSVPTSSLFKTVTVRCGHCSSLLTVDMRGLLFP 97
678*****************************************99876654 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 3.2E-24 | 48 | 98 | IPR006780 | YABBY protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 165 aa Download sequence Send to blast |
MSSSSSSSSS SAATVFPRSP QLPPPVLVEN GLTPLHQLTP VAAAAPAAEQ LCYVHCYFCD 60 TVLVVSVPTS SLFKTVTVRC GHCSSLLTVD MRGLLFPGTP TDTVAGAAPP PAADTSTTTT 120 TITTAPPPAN SVNNGQFHLP HSLNHPHHQS LLVVRAWFKA AGGAS |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.11824 | 0.0 | meristem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G074543 | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G074543_P02 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU962498 | 0.0 | EU962498.1 Zea mays clone 243204 mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001105231.1 | 1e-102 | yabby 9 | ||||
| TrEMBL | A0A060D1X1 | 1e-101 | A0A060D1X1_MAIZE; C2C2-YABBY transcription factor (Fragment) | ||||
| TrEMBL | A0A1D6GNF3 | 1e-102 | A0A1D6GNF3_MAIZE; Yabby9 protein | ||||
| STRING | GRMZM2G074543_P04 | 8e-65 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G00180.1 | 6e-13 | YABBY family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G074543_P02 |




