PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G077789_P02
Common NameLOC100384757
Organism
Zea mays
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB_related
Protein Properties Length: 115aa    MW: 13070 Da    PI: 9.5939
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G077789_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.43.7e-191461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEde+lv +v+ +G g+W++ ++  g+ R++k+c++rw +yl
  GRMZM2G077789_P02 14 KGAWTKEEDERLVAYVRAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
                       79******************************99************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129423.972965IPR017930Myb domain
SMARTSM007174.2E-141363IPR001005SANT/Myb domain
PfamPF002498.5E-171461IPR001005SANT/Myb domain
SuperFamilySSF466892.16E-231589IPR009057Homeodomain-like
CDDcd001672.63E-111661No hitNo description
PROSITE profilePS500905.07662115IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.3E-96588IPR009057Homeodomain-like
SMARTSM007176.366109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0009089anatomyendosperm
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDERLVAYVR AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF TDDEDELIIR LHSLLGNKSV SVCRAAGVLL SSYYSISSRR RCSYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-17139426106MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G077789
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269|PubMed:1840903}.
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, seed pods and flowers. {ECO:0000269|PubMed:1840903}.
UniprotTISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269|PubMed:9839469}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
UniProtTranscription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G077789_P02
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0841450.0BT084145.1 Zea mays full-length cDNA clone ZM_BFb0081D04 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001170687.17e-80uncharacterized protein LOC100384757 isoform 2
SwissprotP813935e-58MYB08_ANTMA; Myb-related protein 308
SwissprotQ9SZP17e-58MYB4_ARATH; Transcription repressor MYB4
TrEMBLC4IZZ82e-78C4IZZ8_MAIZE; Uncharacterized protein
STRINGOGLUM05G18510.16e-60(Oryza glumipatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-59myb domain protein 4
Publications ? help Back to Top
  1. Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
    Expression patterns of myb genes from Antirrhinum flowers.
    Plant Cell, 1991. 3(2): p. 115-25
    [PMID:1840903]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Schenke D,Cai D,Scheel D
    Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification.
    Plant Cell Environ., 2014. 37(7): p. 1716-21
    [PMID:24450952]
  4. Zhou M, et al.
    Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis.
    Plant J., 2015. 84(2): p. 395-403
    [PMID:26332741]
  5. Zhang J, et al.
    Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis.
    Plant Sci., 2016. 248: p. 82-91
    [PMID:27181950]
  6. Zhou M, et al.
    LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis.
    Plant Physiol., 2017. 174(3): p. 1348-1358
    [PMID:28483877]
  7. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]
  8. Verma N,Burma PK
    Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum.
    Plant J., 2017. 92(3): p. 481-494
    [PMID:28849604]