![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G079632_P02 | ||||||||
| Common Name | LOC100273749 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 192aa MW: 21795.8 Da PI: 10.3265 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 168.7 | 1.9e-52 | 24 | 149 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92
lppGfrFhPtdeelv +yL+++++g++ ++ ++i+evd+y+++PwdLp+++ +++ewyfF++rd+ky++g+r+nra+ sgyWkatg dk+v
GRMZM2G079632_P02 24 LPPGFRFHPTDEELVAHYLCARAAGRRPPV-SIIAEVDLYRFDPWDLPERALFGRREWYFFTPRDRKYPNGSRPNRAAGSGYWKATGADKPV 114
79*************************999.89***************87778999************************************ PP
NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
+ +g++ g+kk Lvfy+g+ p+g+kt+W+mheyrl
GRMZM2G079632_P02 115 EH-EGRTAGIKKALVFYHGKPPRGVKTEWIMHEYRL 149
*9.999****************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.01E-59 | 20 | 153 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 53.877 | 24 | 170 | IPR003441 | NAC domain |
| Pfam | PF02365 | 3.0E-27 | 25 | 149 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0025541 | anatomy | bundle sheath cell | ||||
| PO:0025589 | anatomy | leaf lamina tip | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 192 aa Download sequence Send to blast |
MVAMAAVQQQ QQQQRRDAEA ELNLPPGFRF HPTDEELVAH YLCARAAGRR PPVSIIAEVD 60 LYRFDPWDLP ERALFGRREW YFFTPRDRKY PNGSRPNRAA GSGYWKATGA DKPVEHEGRT 120 AGIKKALVFY HGKPPRGVKT EWIMHEYRLA EAGGARAKKS GAGTLRVSGE HIASSLLLPW 180 SLFPRRKEWP GC |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 9e-83 | 12 | 149 | 3 | 140 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.78720 | 0.0 | cell culture| endosperm| glume| meristem| ovary| root | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G079632 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in leaf blades. {ECO:0000269|PubMed:10660065}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G079632_P02 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt and cold stresses (PubMed:18813954, PubMed:20632034). Induced by dehydration and methyl jasmonate (PubMed:20632034). {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:20632034}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT063974 | 0.0 | BT063974.2 Zea mays full-length cDNA clone ZM_BFc0127J10 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001141629.2 | 1e-112 | uncharacterized protein LOC100273749 | ||||
| Swissprot | Q7EZT1 | 7e-87 | NAC67_ORYSJ; NAC domain-containing protein 67 | ||||
| TrEMBL | A0A3L6DX79 | 1e-115 | A0A3L6DX79_MAIZE; NAC domain-containing protein 67 | ||||
| STRING | GRMZM2G079632_P01 | 1e-111 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G27410.2 | 2e-69 | NAC family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G079632_P02 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




