![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G091433_P04 | ||||||||
| Common Name | cl181_1c, ZEAMMB73_475550 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 173aa MW: 19515.5 Da PI: 11.4554 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 59.7 | 6.3e-19 | 7 | 86 | 19 | 98 |
NF-YC 19 helPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
+++P arikki++adedv +i+ +Pvl+s++ elf+ +l r++ + ++ +tl+ ++++v+r fdfl+++v +
GRMZM2G091433_P04 7 TRFPAARIKKIMQADEDVGKIALAVPVLVSRSLELFLQDLIDRTYEITLQSGAKTLNSFHLKQCVKRYSSFDFLTEVVSK 86
579*************************************************************************9976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.6E-25 | 3 | 72 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.73E-20 | 3 | 97 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 6.7E-19 | 8 | 71 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005829 | Cellular Component | cytosol | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0004006 | anatomy | mesophyll cell | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0025589 | anatomy | leaf lamina tip | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 173 aa Download sequence Send to blast |
MRKKLGTRFP AARIKKIMQA DEDVGKIALA VPVLVSRSLE LFLQDLIDRT YEITLQSGAK 60 TLNSFHLKQC VKRYSSFDFL TEVVSKVPDL GGADSCGDER GLPRRRKSNG SDPENDESRS 120 SKMAIRNANI SPRGRGRGRG RGRGRPPTKR KEERKQFKRS MATRPCLKAR NLQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1jfi_A | 1e-23 | 2 | 72 | 5 | 75 | Transcription Regulator NC2 alpha chain |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 102 | 106 | PRRRK |
| 2 | 134 | 143 | RGRGRGRGRG |
| 3 | 134 | 144 | RGRGRGRGRGR |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.96688 | 0.0 | ear| embryo| endosperm| meristem| shoot | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G091433 | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G091433_P04 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF464905 | 0.0 | AF464905.1 Zea mays repressor protein (DrAp1) mRNA, complete cds. | |||
| GenBank | BT035853 | 0.0 | BT035853.1 Zea mays full-length cDNA clone ZM_BFb0086A16 mRNA, complete cds. | |||
| GenBank | HQ858752 | 0.0 | HQ858752.1 Zea mays clone UT1461 CCAAT transcription factor mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001105089.1 | 1e-106 | uncharacterized protein LOC541965 | ||||
| Swissprot | Q2YDP3 | 4e-31 | NC2A_BOVIN; Dr1-associated corepressor | ||||
| TrEMBL | Q8W0W6 | 1e-105 | Q8W0W6_MAIZE; CCAAT-HAP5-transcription factor 59 | ||||
| STRING | GRMZM2G091433_P01 | 1e-106 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G12480.1 | 8e-54 | nuclear factor Y, subunit C11 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G091433_P04 |




