![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G094241_P01 | ||||||||
| Common Name | lg4, lg4a, ZEAMMB73_738901 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | TALE | ||||||||
| Protein Properties | Length: 307aa MW: 33326.4 Da PI: 5.0364 | ||||||||
| Description | TALE family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 28.9 | 1.9e-09 | 239 | 272 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55
+yp++e++ +LA+ +gL+ +q+ +WF N+R ++
GRMZM2G094241_P01 239 WPYPTEEDKVRLAAATGLDPKQINNWFINQRKRH 272
59*****************************885 PP
| |||||||
| 2 | ELK | 33.1 | 1.2e-11 | 192 | 213 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22
ELK++Ll+KYsg+L+ L++EF+
GRMZM2G094241_P01 192 ELKEMLLKKYSGCLSRLRSEFL 213
9********************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM01255 | 1.7E-19 | 51 | 95 | IPR005540 | KNOX1 |
| Pfam | PF03790 | 4.1E-20 | 53 | 92 | IPR005540 | KNOX1 |
| SMART | SM01256 | 2.4E-26 | 99 | 150 | IPR005541 | KNOX2 |
| Pfam | PF03791 | 4.2E-23 | 103 | 149 | IPR005541 | KNOX2 |
| Pfam | PF03789 | 1.4E-8 | 192 | 213 | IPR005539 | ELK domain |
| PROSITE profile | PS51213 | 10.423 | 192 | 212 | IPR005539 | ELK domain |
| SMART | SM01188 | 3.6E-6 | 192 | 213 | IPR005539 | ELK domain |
| PROSITE profile | PS50071 | 12.714 | 212 | 275 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 9.84E-20 | 214 | 284 | IPR009057 | Homeodomain-like |
| SMART | SM00389 | 3.2E-14 | 214 | 279 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 2.8E-27 | 217 | 277 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 3.75E-13 | 224 | 276 | No hit | No description |
| Pfam | PF05920 | 4.9E-17 | 232 | 271 | IPR008422 | Homeobox KN domain |
| PROSITE pattern | PS00027 | 0 | 250 | 273 | IPR017970 | Homeobox, conserved site |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010073 | Biological Process | meristem maintenance | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 307 aa Download sequence Send to blast |
MEDLYSIHPG ISRAGGAATA ASEVSGVAGG PGSPPPPPSQ PPPPPPADLT ELVKAQIAGH 60 PRYPSLLSAY IECRKVGAPP EVATLLEEIG RERCAAASAG GEVGLDPELD EFMEAYCRVL 120 ERYKEELSRP FDEAASFLSS VRTQLSSLCG AAASLSDEMV GSSEEDEACS GGDTEATEPG 180 QQEHSSRLAD RELKEMLLKK YSGCLSRLRS EFLKKRKKGK LPKDARSALM DWWNTHYRWP 240 YPTEEDKVRL AAATGLDPKQ INNWFINQRK RHWKPSEDMR FALMEGVTGG GPSSGTTLYF 300 DTGTIGP |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 207 | 216 | LRSEFLKKRK |
| 2 | 213 | 217 | KKRKK |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.12091 | 0.0 | meristem| ovary| pericarp | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G094241 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Highly expressed in the early globular stage embryo before 2 days after pollination (DAP), but not in the endosperm. At 3 and 4 DAP, expression is restricted to the region around or just below the center of the ventral side of the embryo, where the shoot apex subsequently arises. During the transition to the shoot apex differentiation stage, expression is divided between the upper and basal regions of the shoot area, and the notch between the first leaf primordium and epiblast, respectively. When the first leaf primordia is evident, expression is localized to the notches between the shoot apical meristem (SAM) and the first leaf primordium and the putative second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia, but less well defined than in the previous stage. {ECO:0000269|PubMed:10488233}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may be involved in shoot formation during early embryogenesis. {ECO:0000269|PubMed:10488233}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G094241_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF457118 | 0.0 | AF457118.1 Zea mays knotted1-like homeodomain protein liguleless4a (lg4a) mRNA, complete cds. | |||
| GenBank | BT085252 | 0.0 | BT085252.1 Zea mays full-length cDNA clone ZM_BFb0343E20 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001105084.1 | 0.0 | liguleless 4 | ||||
| Swissprot | Q9FP29 | 1e-146 | KNOS1_ORYSJ; Homeobox protein knotted-1-like 1 | ||||
| TrEMBL | K4JFH7 | 0.0 | K4JFH7_MAIZE; HB-type transcription factor (Fragment) | ||||
| TrEMBL | Q84N17 | 0.0 | Q84N17_MAIZE; Homeotic protein knotted-1 | ||||
| STRING | GRMZM2G094241_P01 | 0.0 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1698 | 38 | 92 | Representative plant | OGRP167 | 17 | 148 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G23380.1 | 2e-80 | KNOTTED1-like homeobox gene 6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G094241_P01 |
| Entrez Gene | 541960 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




