![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G095299_P01 | ||||||||
| Common Name | Zm.93727 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | DBB | ||||||||
| Protein Properties | Length: 254aa MW: 27476 Da PI: 6.2204 | ||||||||
| Description | DBB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-B_box | 23.2 | 1.5e-07 | 4 | 46 | 5 | 41 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
C+ +e ++ C ++ lC+ C +e+H H++ p
GRMZM2G095299_P01 4 QCDACEGAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 46
7******99*********************6678888898877 PP
| |||||||
| 2 | zf-B_box | 27.7 | 5.7e-09 | 53 | 85 | 2 | 34 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeH 34
+ ++C+ ++ek + +fC +++ l+C+dC + +H
GRMZM2G095299_P01 53 KLPRCDVCQEKAAFIFCVEDRALFCQDCDEPIH 85
5789**************************999 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50119 | 10.011 | 1 | 47 | IPR000315 | B-box-type zinc finger |
| CDD | cd00021 | 6.87E-6 | 3 | 47 | No hit | No description |
| SMART | SM00336 | 2.1E-9 | 4 | 47 | IPR000315 | B-box-type zinc finger |
| Pfam | PF00643 | 1.1E-5 | 4 | 47 | IPR000315 | B-box-type zinc finger |
| SMART | SM00336 | 2.4E-13 | 52 | 99 | IPR000315 | B-box-type zinc finger |
| PROSITE profile | PS50119 | 8.702 | 52 | 99 | IPR000315 | B-box-type zinc finger |
| Pfam | PF00643 | 5.1E-7 | 53 | 95 | IPR000315 | B-box-type zinc finger |
| CDD | cd00021 | 1.26E-6 | 55 | 85 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005622 | Cellular Component | intracellular | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 254 aa Download sequence Send to blast |
MKIQCDACEG AAATVVCCAD EAALCARCDV EIHAANKLAS KHQRLPLEAL SAKLPRCDVC 60 QEKAAFIFCV EDRALFCQDC DEPIHVPGTL SGNHQRYLAT GIRVGLASAS ACSDACDAHD 120 SDHHAPPKAT IEPPHAAVSA AVQQVPSPPQ FLPQGWAVDE LLQFSDYESS DKLHKEPTLG 180 FKELEWFADI DLFHEQAPKA SRTLADVPEL FGYQAANDAA YYRPAKPPSA ALGFARAKKG 240 PDRGHRRRGL PHSP |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.93727 | 0.0 | aerial organ| leaf| meristem| ovary| root| sheath| shoot | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G095299 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Acts as negative regulator of seedling photomorphogenesis (PubMed:18540109). BBX25/STH and BBX24/STO function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX25/STH acts additively with BBX24/STO during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). {ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:23624715}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G095299_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT039586 | 0.0 | BT039586.1 Zea mays full-length cDNA clone ZM_BFc0031F03 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001151151.2 | 1e-164 | uncharacterized protein LOC100284784 | ||||
| Swissprot | Q9SID1 | 1e-69 | BBX25_ARATH; B-box zinc finger protein 25 | ||||
| TrEMBL | B4FR48 | 1e-162 | B4FR48_MAIZE; Uncharacterized protein | ||||
| TrEMBL | B6TXF7 | 1e-162 | B6TXF7_MAIZE; Salt tolerance-like protein | ||||
| STRING | GRMZM2G095299_P01 | 0.0 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3202 | 33 | 68 | Representative plant | OGRP5397 | 10 | 20 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G06040.1 | 2e-68 | DBB family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G095299_P01 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




