![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G104390_P01 | ||||||||
| Common Name | LOC100285453, ZEAMMB73_131327 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 139aa MW: 14865.9 Da PI: 10.4066 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 61.6 | 9.4e-20 | 35 | 69 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C+ C++t+Tp+WR+gp g+++LCnaCG++yrkk++
GRMZM2G104390_P01 35 CVECRATTTPMWRSGPTGPRSLCNACGIRYRKKRR 69
********************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 13.244 | 29 | 65 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 4.4E-16 | 29 | 83 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.09E-13 | 30 | 69 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 4.9E-16 | 33 | 70 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 5.53E-13 | 34 | 70 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 35 | 60 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 1.7E-17 | 35 | 69 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
MSSAAGRAPA PTPMGSADRC KIDGIVAAEK ATRSCVECRA TTTPMWRSGP TGPRSLCNAC 60 GIRYRKKRRQ ELGLDRKLQQ QQNNGEAKTD EAKDSSSNSS SGSSNLQVVQ KRRLLMGVEE 120 AALLLMTLSS SPTSTLLHG |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.9650 | 0.0 | meristem| shoot | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G104390 | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G104390_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT041227 | 0.0 | BT041227.1 Zea mays full-length cDNA clone ZM_BFc0190F05 mRNA, complete cds. | |||
| GenBank | EU972328 | 0.0 | EU972328.1 Zea mays clone 379713 GATA transcription factor 22 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001151818.1 | 1e-97 | GATA transcription factor 22 | ||||
| TrEMBL | B4FVT9 | 2e-96 | B4FVT9_MAIZE; GATA transcription factor 16 | ||||
| STRING | GRMZM2G104390_P01 | 4e-97 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6721 | 28 | 54 | Representative plant | OGRP68 | 17 | 287 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26930.1 | 9e-19 | GATA transcription factor 23 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G104390_P01 |
| Entrez Gene | 100285453 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




