![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G104789_P02 | ||||||||
| Common Name | Zm.13874 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 206aa MW: 23354.5 Da PI: 9.6548 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 51.6 | 2.2e-16 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
+g+W++eEd +l+ +++q G+g +W + ++++g++R++k+c++rw++yl
GRMZM2G104789_P02 14 KGPWSPEEDAKLKSYIEQNGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
79*********************************************97 PP
| |||||||
| 2 | Myb_DNA-binding | 37.6 | 4.9e-12 | 70 | 111 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
++ eEd +++ + G++ W+ Ia+ ++ gRt++++k++w++
GRMZM2G104789_P02 70 GFSDEEDMIILSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
699*****************.*********.***********97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 13.588 | 9 | 62 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 5.31E-26 | 12 | 109 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 6.5E-12 | 13 | 64 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.4E-15 | 14 | 62 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-24 | 15 | 69 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.12E-8 | 16 | 62 | No hit | No description |
| PROSITE profile | PS51294 | 20.751 | 63 | 117 | IPR017930 | Myb domain |
| SMART | SM00717 | 4.1E-11 | 67 | 115 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.3E-10 | 69 | 111 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.7E-23 | 70 | 117 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 3.77E-8 | 71 | 113 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 206 aa Download sequence Send to blast |
MGRAPCCDKA TVKKGPWSPE EDAKLKSYIE QNGTGGNWIA LPQKIGLKRC GKSCRLRWLN 60 YLRPNIKHGG FSDEEDMIIL SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLFGK 120 PFKKESNPCL WVIASSISKM HAIYAVCSFR VELVRCLFLS CAFFCMHHIS HISLYCSVLP 180 LLCGILRVLS VNIPASIQED RVFEGK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 9e-25 | 14 | 117 | 7 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G104789 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: In roots, expressed in endodermal cells from the late elongation zones to the differentiation zone and, to a lower extent, in endodermal cells of the meristematic zone. {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in leaves, roots (endodermis-specific) and seedlings. {ECO:0000269|PubMed:16461581, ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322, ECO:0000269|PubMed:9839469}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G104789_P02 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK112018 | 1e-136 | AK112018.1 Oryza sativa Japonica Group cDNA clone:006-308-C02, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020393436.1 | 4e-85 | transcription factor MYB2 isoform X1 | ||||
| Swissprot | Q9FKL2 | 1e-77 | MYB36_ARATH; Transcription factor MYB36 | ||||
| TrEMBL | A0A1D6GGA4 | 1e-150 | A0A1D6GGA4_MAIZE; R2R3MYB-domain protein | ||||
| STRING | GRMZM2G104789_P01 | 7e-84 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G49690.1 | 1e-75 | myb domain protein 84 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G104789_P02 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




