![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G105387_P01 | ||||||||
| Common Name | ZEAMMB73_698020, Zm.11627 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 75aa MW: 8260.81 Da PI: 10.4689 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 78.5 | 4.6e-25 | 10 | 56 | 2 | 48 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
r+en rqvtf+kRr+g+lKKA ELSvLCda v +i+fs +gkly+
GRMZM2G105387_P01 10 RVENPVHRQVTFCKRRAGLLKKARELSVLCDASVGIIVFSAHGKLYD 56
789******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 3.4E-25 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.2E-33 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 29.156 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.12E-34 | 2 | 61 | No hit | No description |
| PRINTS | PR00404 | 5.9E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.3E-23 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.9E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.9E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 75 aa Download sequence Send to blast |
MARGKVQLRR VENPVHRQVT FCKRRAGLLK KARELSVLCD ASVGIIVFSA HGKLYDLATT 60 GYAVQHALHA CALLC |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 2e-16 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_B | 2e-16 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_C | 2e-16 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_D | 2e-16 | 1 | 61 | 1 | 61 | MEF2C |
| 6bz1_A | 2e-16 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_B | 2e-16 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_C | 2e-16 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_D | 2e-16 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G105387 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in leaves and spikelets (rice flower). {ECO:0000269|Ref.7}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| UniProt | Probable transcription factor. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G105387_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT085001 | 1e-97 | BT085001.1 Zea mays full-length cDNA clone ZM_BFb0224I24 mRNA, complete cds. | |||
| GenBank | KJ728189 | 1e-97 | KJ728189.1 Zea mays clone pUT6462 MADS transcription factor (MADS32) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023157970.1 | 1e-37 | MADS-box transcription factor 26 isoform X5 | ||||
| Swissprot | A2YQK9 | 3e-36 | MAD26_ORYSI; MADS-box transcription factor 26 | ||||
| Swissprot | Q0J8G8 | 3e-36 | MAD26_ORYSJ; MADS-box transcription factor 26 | ||||
| TrEMBL | A0A0E0LQL4 | 1e-35 | A0A0E0LQL4_ORYPU; Uncharacterized protein | ||||
| STRING | OPUNC08G01030.1 | 2e-36 | (Oryza punctata) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71692.1 | 1e-33 | AGAMOUS-like 12 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G105387_P01 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




