PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GRMZM2G106560_P02

Common Name

Zm.9674

Organism

Zea mays

Taxonomic ID

4577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

WRKY

Protein Properties

Length: 76aa MW: 8852.88 Da PI: 8.1032

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G106560_P02	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	59.7	5.7e-19	2	42	19	59
SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 19 efprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ++ rsYYrCt++gC+vkk+v+r ++d+ vv++tYeg+H+h+ GRMZM2G106560_P02 2 PCQRSYYRCTHQGCNVKKQVQRLSRDEGVVVTTYEGTHTHP 42 578*************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50811	18.051	1	44	IPR003657	WRKY domain
SMART	SM00774	2.4E-12	2	43	IPR003657	WRKY domain
SuperFamily	SSF118290	5.1E-16	2	43	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	3.4E-17	2	42	IPR003657	WRKY domain
Pfam	PF03106	5.3E-15	2	42	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 76 aa Download sequence Send to blast
MPCQRSYYRC THQGCNVKKQ VQRLSRDEGV VVTTYEGTHT HPIEKSNDNF EHILTQMQIY 60 SGMGSTFSRS SHDMFH

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G106560

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G106560_P02

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KJ728200	1e-116	KJ728200.1 Zea mays clone pUT6475 WRKY transcription factor (WRKY108) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008670731.2	9e-48	probable WRKY transcription factor 45
Swissprot	Q9FYA2	2e-28	WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBL	A0A060CYT2	2e-46	A0A060CYT2_MAIZE; WRKY transcription factor (Fragment)
TrEMBL	A0A1D6F5K4	2e-46	A0A1D6F5K4_MAIZE; Putative WRKY transcription factor 75
TrEMBL	A0A3L6FS40	2e-46	A0A3L6FS40_MAIZE; Putative WRKY transcription factor 75
STRING	GRMZM2G106560_P01	3e-47	(Zea mays)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13080.1	8e-31	WRKY DNA-binding protein 75

Link Out ? help Back to Top
Phytozome	GRMZM2G106560_P02

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] Xu L, et al. Overexpression of GbWRKY1 positively regulates the Pi starvation response by alteration of auxin sensitivity in Arabidopsis. Plant Cell Rep., 2012. 31(12): p. 2177-88 [PMID:22890372] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schmiesing A,Emonet A,Gouhier-Darimont C,Reymond P Arabidopsis MYC Transcription Factors Are the Target of Hormonal Salicylic Acid/Jasmonic Acid Cross Talk in Response to Pieris brassicae Egg Extract. Plant Physiol., 2016. 170(4): p. 2432-43 [PMID:26884488] Velasco VM, et al. Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes. Plant Cell Environ., 2016. 39(8): p. 1818-34 [PMID:27038434] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhang H,Huang L,Hong Y,Song F BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana. BMC Plant Biol., 2016. 16(1): p. 152 [PMID:27389008] Zhang S, et al. The Arabidopsis Mitochondrial Protease FtSH4 Is Involved in Leaf Senescence via Regulation of WRKY-Dependent Salicylic Acid Accumulation and Signaling. Plant Physiol., 2017. 173(4): p. 2294-2307 [PMID:28250067] Guo P, et al. A Tripartite Amplification Loop Involving the Transcription Factor WRKY75, Salicylic Acid, and Reactive Oxygen Species Accelerates Leaf Senescence. Plant Cell, 2017. 29(11): p. 2854-2870 [PMID:29061866] Zhang L,Chen L,Yu D Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering. Plant Physiol., 2018. 176(1): p. 790-803 [PMID:29133369]