PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G111045_P03
Common NameLOC100272429, ZEAMMB73_490608
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB_related
Protein Properties Length: 52aa    MW: 5815.68 Da    PI: 9.2905
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G111045_P03genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.81.8e-111546132
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                       +g+WT+eEd+llvd+++  G g+W++ ++  g
  GRMZM2G111045_P03 15 KGPWTPEEDKLLVDYIQTNGHGSWRLLPKLAG 46
                       79**************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.4821052IPR017930Myb domain
SuperFamilySSF466892.01E-91044IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-121346IPR009057Homeodomain-like
PfamPF002492.4E-91546IPR001005SANT/Myb domain
CDDcd001671.08E-51746No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 52 aa     Download sequence    Send to blast
MGRAPCCDKN KGLKKGPWTP EEDKLLVDYI QTNGHGSWRL LPKLAGQNSS LY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1001021e-72meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G111045
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Specifically and transiently expressed in root endodermal cells overlying the early stages of lateral root primordia formation. {ECO:0000269|PubMed:24902892, ECO:0000269|PubMed:25482809}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G111045_P03
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4700742e-83AF470074.1 Zea mays A-type R2R3 Myb protein (Myb7) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140376.16e-27uncharacterized protein LOC100272429
SwissprotQ9S9Z24e-19MYB93_ARATH; Transcription factor MYB93
TrEMBLA0A3L6F8R01e-25A0A3L6F8R0_MAIZE; Transcription factor MYB74
TrEMBLB4FNK51e-25B4FNK5_MAIZE; MYB transcription factor
TrEMBLQ8S4309e-27Q8S430_MAIZE; A-type R2R3 Myb protein (Fragment)
STRINGGRMZM2G111045_P012e-26(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.12e-21myb domain protein 93
Publications ? help Back to Top
  1. Gibbs DJ,Coates JC
    AtMYB93 is an endodermis-specific transcriptional regulator of lateral root development in arabidopsis.
    Plant Signal Behav, 2014. 9(10): p. e970406
    [PMID:25482809]