![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G112263_P01 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 89aa MW: 10224.7 Da PI: 11.2546 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 61.1 | 2.4e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rgrWT+eEd+ll+++++++G g+W++ ++ g+ R++k+c++rw +yl
GRMZM2G112263_P01 14 RGRWTAEEDQLLANYIAEHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
8*******************************99************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-23 | 5 | 71 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 22.241 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 3.0E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 8.7E-18 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 6.9E-18 | 15 | 71 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.22E-11 | 16 | 61 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MGRAPCCEKV GLKRGRWTAE EDQLLANYIA EHGEGSWRSL PKNAGLLRCG KSCRLRWINY 60 LRADVKRGNI SKGGRRHHHQ APRHPRQQV |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.584 | 1e-144 | meristem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G112263 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G112263_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ728395 | 1e-144 | KJ728395.1 Zea mays clone pUT6679 MYB transcription factor (MYB3) mRNA, partial cds. | |||
| GenBank | ZMU57002 | 1e-144 | U57002.1 Zea mays P protein (P) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020401761.1 | 2e-45 | myb-related protein P-like | ||||
| Swissprot | P27898 | 2e-44 | MYBP_MAIZE; Myb-related protein P | ||||
| TrEMBL | A0A096PZZ6 | 3e-45 | A0A096PZZ6_MAIZE; MYB-related transcription factor (Fragment) | ||||
| TrEMBL | A0A317Y7V1 | 3e-45 | A0A317Y7V1_MAIZE; Myb-related protein P | ||||
| TrEMBL | Q8S431 | 3e-45 | Q8S431_MAIZE; A-type R2R3 Myb protein (Fragment) | ||||
| STRING | GRMZM2G016020_P01 | 5e-46 | (Zea mays) | ||||
| STRING | GRMZM2G057027_P02 | 9e-45 | (Zea mays) | ||||
| STRING | GRMZM2G129872_P01 | 5e-46 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47460.1 | 4e-41 | myb domain protein 12 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G112263_P01 |




