![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G113779_P01 | ||||||||
| Common Name | SBP13, Zm.20782 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 99aa MW: 11294.6 Da PI: 10.6472 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 117.8 | 5.6e-37 | 1 | 68 | 11 | 78 |
-TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
SBP 11 lseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
++e k y+rrhkvCe+hskapvvlv+gl+qrfCqqCsrfhelsefD+ krsCr rLa+hnerrrk++a
GRMZM2G113779_P01 1 MTEEKPYNRRHKVCEAHSKAPVVLVAGLRQRFCQQCSRFHELSEFDDVKRSCRLRLAGHNERRRKSSA 68
57899************************************************************976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51141 | 27.231 | 1 | 66 | IPR004333 | Transcription factor, SBP-box |
| Gene3D | G3DSA:4.10.1100.10 | 6.5E-27 | 2 | 53 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 2.1E-28 | 2 | 65 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 1.09E-32 | 2 | 70 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
MTEEKPYNRR HKVCEAHSKA PVVLVAGLRQ RFCQQCSRFH ELSEFDDVKR SCRLRLAGHN 60 ERRRKSSADA HAGGGNNGFR QHADQNGRGD PAGNHFQIR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 6e-29 | 1 | 65 | 20 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.20782 | 1e-169 | ear| meristem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G113779 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00359 | DAP | Transfer from AT3G15270 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G113779_P01 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT065445 | 1e-167 | BT065445.2 Zea mays full-length cDNA clone ZM_BFb0161D05 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002462902.1 | 6e-50 | squamosa promoter-binding-like protein 13 | ||||
| Swissprot | Q6Z461 | 2e-36 | SPL13_ORYSJ; Squamosa promoter-binding-like protein 13 | ||||
| TrEMBL | A0A1D6EWJ8 | 2e-68 | A0A1D6EWJ8_MAIZE; Squamosa promoter-binding-like protein 5 | ||||
| STRING | GRMZM2G113779_P01 | 1e-67 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP8524 | 32 | 48 | Representative plant | OGRP97 | 17 | 230 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G15270.1 | 4e-34 | squamosa promoter binding protein-like 5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G113779_P01 |




