![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G114775_P01 | ||||||||
| Common Name | GATA18, LOC100276694 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 163aa MW: 17989.5 Da PI: 10.626 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 56.6 | 3.5e-18 | 28 | 62 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C+ C+ttkTplWR gp g+ +LCnaCG++yrkk++
GRMZM2G114775_P01 28 CTECHTTKTPLWRGGPCGPMSLCNACGIRYRKKRR 62
********************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 1.81E-13 | 21 | 61 | No hit | No description |
| PROSITE profile | PS50114 | 12.558 | 22 | 58 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 6.2E-15 | 22 | 74 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 3.1E-14 | 23 | 62 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 2.50E-14 | 27 | 62 | No hit | No description |
| Pfam | PF00320 | 5.9E-16 | 28 | 62 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 28 | 53 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 163 aa Download sequence Send to blast |
MDSSVEKQGS VALDPDERAP ASGETKACTE CHTTKTPLWR GGPCGPMSLC NACGIRYRKK 60 RREAMGLESS SKAATAGGSE HQQQQRKKKA TAAAAAASSK RERERERERN KEADEVTVEL 120 RAVGFGKEVV LKQRRRMRRR RRLGEEERAA ILLMALSSGV VYA |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 132 | 138 | QRRRMRR |
| 2 | 134 | 139 | RRMRRR |
| 3 | 134 | 141 | RRMRRRRR |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.94446 | 0.0 | ear| endosperm| meristem| ovary| shoot| tassel | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G114775 | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G114775_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ728013 | 0.0 | KJ728013.1 Zea mays clone pUT6148 C2C2-GATA transcription factor (GATA18) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001143893.1 | 7e-82 | uncharacterized protein LOC100276694 | ||||
| TrEMBL | A0A060D834 | 1e-113 | A0A060D834_MAIZE; C2C2-GATA transcription factor (Fragment) | ||||
| STRING | GRMZM2G114775_P01 | 1e-113 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2418 | 38 | 92 | Representative plant | OGRP68 | 17 | 287 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G49300.1 | 1e-18 | GATA transcription factor 16 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G114775_P01 |




