PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G118047_P02
Common NameZEAMMB73_566713, Zm.2008
Organism
Zea mays
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HSF
Protein Properties Length: 73aa    MW: 7725.65 Da    PI: 7.696
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G118047_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind74.22.4e-231371260
                       HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
       HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                       F+ k+y+++ed+ +  +i w + +nsfvv d+  f++++Lp +Fkh+nf+SFvRQLn+Y
  GRMZM2G118047_P02 13 FVWKTYTMVEDPGTAGVIGWGSGNNSFVVADPFVFSQTLLPAHFKHNNFSSFVRQLNTY 71
                       9*********************************************************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.102.0E-25971IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004156.2E-12973IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467851.36E-211271IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000567.1E-131336IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004472.6E-181371IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000567.1E-135163IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000567.1E-136473IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020127anatomyprimary root
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
MAAGGGGGSP APFVWKTYTM VEDPGTAGVI GWGSGNNSFV VADPFVFSQT LLPAHFKHNN  60
FSSFVRQLNT YVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5w_B3e-181171262Putative transcription factor
5d5x_B3e-181171262Putative transcription factor
5d5x_E3e-181171262Putative transcription factor
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.20081e-123leaf
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G118047
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G118047_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0546731e-121BT054673.2 Zea mays full-length cDNA clone ZM_BFb0064N21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266312.23e-45heat shock factor protein 3
SwissprotQ0DBL62e-36HFC2B_ORYSJ; Heat stress transcription factor C-2b
TrEMBLA0A3L6DHS77e-44A0A3L6DHS7_MAIZE; Heat stress transcription factor C-2b
TrEMBLB6SNL96e-45B6SNL9_MAIZE; Uncharacterized protein
TrEMBLC0PLU12e-44C0PLU1_MAIZE; Uncharacterized protein
TrEMBLK0DG807e-44K0DG80_MAIZE; HSF28 HSF type transcription factor (Fragment)
TrEMBLK7V9Y47e-44K7V9Y4_MAIZE; HSF28 HSF type transcription factor
STRINGGRMZM2G118047_P011e-44(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24520.11e-26heat shock transcription factor C1